BioLiP

>protein
LSKVRIEFNTLDPRLASCVEFLAQCNARKAKESNPNCQVLVKRRTDEQPPQITVTFVNGVEEAFDAAATSAQSIRKMILD
K

The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6xyw:AJ	81	81	1.0000	1.0000	1.0000	1.50e-55
2	8oir:Bb	101	57	0.2099	0.1683	0.2982	7.38e-04	6gaw:Bp, 6gb2:Bp, 7nqh:Bp, 7nql:Bp, 7nsh:Bp, 7nsi:Bp, 7nsj:Bp, 7o9m:k, 7of6:k, 8oit:Bb, 8pk0:k, 7qi5:k, 8xt0:L3, 8xt1:L3, 6ydp:Bp, 6ydw:Bp, 6zm5:k
3	8dyu:A	2562	38	0.1852	0.0059	0.3947	1.4	8dyv:A
4	5di3:B	204	26	0.1605	0.0637	0.5000	2.0	4m9q:A, 4m9q:B, 4m9q:C
5	4zg8:A	426	27	0.1481	0.0282	0.4444	2.1	4zg8:B, 4zh5:A, 4zh5:B
6	8fcy:A	2864	31	0.1728	0.0049	0.4516	2.7	8fd6:A, 8fdt:A
7	7z8g:A	3047	31	0.1728	0.0046	0.4516	2.7	8fdu:A, 7z8l:f
8	6fca:A	209	49	0.2346	0.0909	0.3878	2.9	6fct:A, 6fcw:A, 6fcy:A, 6fd9:A, 6ftt:E, 6ftt:H, 6ftt:G, 6ftt:F, 6fu2:C, 6fu2:D, 6fu7:C, 6fu7:D, 6fua:C, 6fua:D, 6r02:E, 6r02:F, 6r02:G, 6r02:H, 7z6r:C, 7z6r:D, 7z8u:A
9	1djn:A	729	33	0.1481	0.0165	0.3636	3.3	1djn:B, 1djq:A, 1djq:B, 1o94:A, 1o94:B, 1o95:A, 1o95:B, 2tmd:A, 2tmd:B
10	3ec6:A	129	31	0.1605	0.1008	0.4194	4.3
11	7z8f:e	4579	31	0.1728	0.0031	0.4516	5.3	5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A
12	5okn:G	402	49	0.1481	0.0299	0.2449	5.4	6squ:A
13	8ptk:f	4502	39	0.1975	0.0036	0.4103	6.1	8ptk:e
14	6ywe:j	195	52	0.1852	0.0769	0.2885	6.3	6yws:j, 6ywx:j, 6ywy:j
15	5nug:A	2920	39	0.1975	0.0055	0.4103	7.0	5nug:B
16	8pqw:A	2892	39	0.1975	0.0055	0.4103	7.2	8pqy:A, 8pqz:A, 8pqz:J
17	1jv1:A	490	36	0.1605	0.0265	0.3611	8.2	1jv1:B, 1jv3:A, 1jv3:B, 1jvd:A, 1jvd:B, 1jvg:A, 1jvg:B, 6z2f:A, 6z2f:B

[Back]