LSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLE
TIGVKDLE
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yl6:A | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 4.29e-61 | |
2 | 1ord:A | 730 | 80 | 0.2841 | 0.0342 | 0.3125 | 0.081 | 1c4k:A, 1ord:B |
3 | 8om2:2 | 102 | 36 | 0.1591 | 0.1373 | 0.3889 | 0.69 | 8d8j:2, 8d8k:2, 8d8l:2, 5mrc:22, 5mre:22, 5mrf:22, 8om3:2, 8om4:2 |
4 | 5v5z:A | 488 | 25 | 0.1364 | 0.0246 | 0.4800 | 4.6 | 5fsa:A, 5fsa:B, 5tz1:A, 5tz1:B |
5 | 6zdp:A | 683 | 54 | 0.1591 | 0.0205 | 0.2593 | 7.1 | |
6 | 8gs8:A | 614 | 41 | 0.1705 | 0.0244 | 0.3659 | 9.7 | 3abv:A, 3ae1:A, 3ae2:A, 3ae3:A, 3ae4:A, 3ae5:A, 3ae6:A, 3ae7:A, 3ae8:A, 3ae9:A, 3aea:A, 3aeb:A, 3aec:A, 3aed:A, 3aee:A, 3aef:A, 3aeg:A, 8dyd:A, 8dye:A, 2fbw:A, 2fbw:N, 2h88:A, 2h88:N, 2h89:A, 6myo:A, 6myp:A, 6myq:A, 6myr:A, 6mys:A, 6myt:A, 6myu:A, 3sfd:A, 3sfe:A, 6vax:A, 6vax:C, 2wqy:A, 2wqy:N, 1yq3:A, 1yq4:A, 4ytp:A, 4yxd:A, 1zoy:A, 1zp0:A |