Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
LRAPIITVFDARGCREHKNREYKGPKTGTQDDEMCVKVQYEKIAACEDTAFIVLKECLSEMKS

The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7sut:C 63 63 1.0000 1.0000 1.0000 5.39e-43 7sut:G
2 4lms:C 68 64 0.6032 0.5588 0.5938 2.84e-24
3 7t7u:C 70 62 0.5238 0.4714 0.5323 3.82e-21
4 7t8s:B 78 58 0.5397 0.4359 0.5862 7.69e-18 7t8s:F, 7t8s:J, 7t8s:N
5 7t8s:D 70 61 0.5397 0.4857 0.5574 1.54e-16 7t8s:H, 7t8s:L, 7t8s:P
6 4lms:A 80 58 0.4603 0.3625 0.5000 2.17e-14
7 7tja:G 67 60 0.4921 0.4627 0.5167 3.24e-14 7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O
8 1qgw:B 67 60 0.4603 0.4328 0.4833 1.22e-12 1xf6:B, 1xg0:B
9 7t7u:A 81 58 0.4127 0.3210 0.4483 2.61e-10
10 7tja:I 75 57 0.3968 0.3333 0.4386 1.33e-09 7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M
11 1qgw:A 76 58 0.4127 0.3421 0.4483 2.11e-09 1xf6:A, 1xg0:A
12 7sut:A 78 48 0.2857 0.2308 0.3750 6.93e-06 7sut:E
13 8ffm:A 623 37 0.2540 0.0257 0.4324 0.26 8ffm:B, 8ffm:C, 8ffm:D, 7n0m:A, 7n0m:D, 7n0m:B, 7n0m:C, 8slx:A, 8slx:B, 8slx:C, 8slx:D, 8sly:A, 8sly:D, 8sly:B, 8sly:C, 7t37:A, 7t37:B, 7t37:C, 7t37:D, 6u88:A, 6u88:D, 6u88:B, 6u88:C, 6u8a:A, 6u8a:B, 6u8a:D, 6u8a:C, 6wkn:A, 6wkn:B, 6wkn:C, 6wkn:D, 7xem:A, 7xem:B, 7xem:C, 7xem:D, 7xer:A, 7xer:B, 7xer:C, 7xer:D, 7xeu:A, 7xeu:B, 7xeu:C, 7xeu:D, 7xev:A, 7xev:B, 7xev:C, 7xev:D, 7yep:A, 7yep:B, 7yep:C, 7yep:D
14 4nfu:A 619 44 0.1905 0.0194 0.2727 0.52 7xey:A
15 7xjp:A 580 44 0.1746 0.0190 0.2500 1.1
16 8pn7:A 506 15 0.1587 0.0198 0.6667 1.2 8pn7:B, 8pn7:C, 8pn7:D, 8pn7:E, 8pn7:F, 8pn8:A, 8pn8:B, 8pn8:C, 8pn8:D, 8pn8:E, 8pn8:F, 6ybp:A, 6ybp:F, 6ybq:A, 6ybq:C, 6ybq:D, 6ybq:E, 6ybq:F
17 3oqg:A 176 24 0.1587 0.0568 0.4167 6.5 3oqg:B, 3or3:A, 3or3:B
18 6i71:A 353 27 0.1587 0.0283 0.3704 9.9 6i71:B, 6i72:A, 6i72:B, 6i73:A, 6i73:B, 6yjw:A, 6yjw:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218