LQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELSVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRHVYYQLQDHHIV
ALYQNALDHLQES
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1r23:A | 104 | 97 | 0.9785 | 0.8750 | 0.9381 | 1.56e-57 | 1r22:A, 1r22:B, 1r23:B |
2 | 6cdb:A | 97 | 90 | 0.3441 | 0.3299 | 0.3556 | 1.86e-13 | 6cda:A, 6cdb:B, 4ggg:A, 4ggg:B, 2m30:A, 2m30:B, 1r1v:A |
3 | 4omy:A | 97 | 78 | 0.3333 | 0.3196 | 0.3974 | 3.09e-10 | 4omy:B, 4omy:C, 4omy:D, 4on0:A, 4on0:B, 4on0:C, 4on0:D |
4 | 1u2w:B | 107 | 87 | 0.3011 | 0.2617 | 0.3218 | 3.19e-07 | 1u2w:A, 1u2w:C |
5 | 2jsc:B | 97 | 73 | 0.3118 | 0.2990 | 0.3973 | 3.26e-06 | 2jsc:A |
6 | 1u2w:D | 94 | 83 | 0.2796 | 0.2766 | 0.3133 | 4.82e-05 | |
7 | 4kdp:A | 151 | 40 | 0.1505 | 0.0927 | 0.3500 | 0.19 | 4ejv:A, 4ejv:B, 4ejw:A, 4ejw:B, 4kdp:B, 4kdp:C, 4kdp:D, 3kp2:A, 3kp2:B, 3kp3:B, 3kp4:A, 3kp4:B, 3kp5:A, 3kp5:B |
8 | 2pij:A | 59 | 27 | 0.1183 | 0.1864 | 0.4074 | 1.3 | |
9 | 2vxx:B | 173 | 44 | 0.1398 | 0.0751 | 0.2955 | 1.4 | 2vxx:A, 2vxx:D, 2vxx:C |
10 | 8y6u:H | 92 | 40 | 0.1720 | 0.1739 | 0.4000 | 1.5 | 8y6u:J |
11 | 5b6a:A | 288 | 43 | 0.1828 | 0.0590 | 0.3953 | 3.8 | |
12 | 8pw0:A | 137 | 47 | 0.1935 | 0.1314 | 0.3830 | 4.4 | |
13 | 6rtg:A | 503 | 26 | 0.1183 | 0.0219 | 0.4231 | 5.1 | |
14 | 8c3a:w | 199 | 47 | 0.1613 | 0.0754 | 0.3191 | 5.1 | 8c3a:BJ, 8cq7:w, 8cq7:BJ, 8cqw:w, 8cqw:BJ, 8cre:w, 8cre:BJ, 8oeq:w, 8oeq:BJ, 7pzy:w, 7q08:w, 7q0f:w, 7q0p:w, 7q0r:w, 8q5i:w |
15 | 8qto:A | 234 | 49 | 0.1075 | 0.0427 | 0.2041 | 5.4 | 5cvr:A, 5e44:A |
16 | 4x2h:A | 192 | 63 | 0.1935 | 0.0938 | 0.2857 | 7.2 | 4x2o:A |