LQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQD
HHIVALYQNALDHLQEC
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1r23:A | 104 | 97 | 1.0000 | 0.9327 | 1.0000 | 1.33e-65 | 1r22:A, 1r22:B, 1r23:B |
2 | 6cdb:A | 97 | 90 | 0.3402 | 0.3402 | 0.3667 | 1.98e-17 | 6cda:A, 6cdb:B, 4ggg:A, 4ggg:B, 2m30:A, 2m30:B, 1r1v:A |
3 | 4omy:A | 97 | 88 | 0.3196 | 0.3196 | 0.3523 | 1.22e-12 | 4omy:B, 4omy:C, 4omy:D, 4on0:A, 4on0:B, 4on0:C, 4on0:D |
4 | 1u2w:B | 107 | 87 | 0.3196 | 0.2897 | 0.3563 | 1.77e-12 | 1u2w:A, 1u2w:C |
5 | 2jsc:B | 97 | 73 | 0.2990 | 0.2990 | 0.3973 | 3.14e-08 | 2jsc:A |
6 | 6o8m:A | 95 | 86 | 0.2680 | 0.2737 | 0.3023 | 7.34e-07 | |
7 | 1u2w:D | 94 | 87 | 0.2784 | 0.2872 | 0.3103 | 1.79e-05 | |
8 | 4kdp:A | 151 | 70 | 0.1959 | 0.1258 | 0.2714 | 0.063 | 4ejv:A, 4ejv:B, 4ejw:A, 4ejw:B, 4kdp:B, 4kdp:C, 4kdp:D, 3kp2:A, 3kp2:B, 3kp3:B, 3kp4:A, 3kp4:B, 3kp5:A, 3kp5:B |
9 | 7mq8:LW | 453 | 56 | 0.1753 | 0.0375 | 0.3036 | 0.74 | 7mq9:LW |
10 | 7mqa:LW | 452 | 56 | 0.1753 | 0.0376 | 0.3036 | 0.86 | |
11 | 8y6u:H | 92 | 53 | 0.1959 | 0.2065 | 0.3585 | 1.0 | 8y6u:J |
12 | 2pij:A | 59 | 32 | 0.1340 | 0.2203 | 0.4062 | 1.1 | |
13 | 9bh5:AK | 93 | 41 | 0.1649 | 0.1720 | 0.3902 | 2.3 | 9cai:AK |
14 | 1f9w:A | 300 | 54 | 0.1753 | 0.0567 | 0.3148 | 4.3 | 1f9w:B |