LPPLRLAIACDDAGVSYKEALKAHLSDNPLVSSITDVGVTSTTDKTAYPHVAIQAAQLIKDGKVDRALMICGTGLGVAIS
ANKVPGIRAVTAHDTFSVERAILSNDAQVLCFGQRVIGIELAKRLAGEWLTYRFDQKSASAQKVQAISDYEKKFVEVN
The query sequence (length=158) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3sgw:A | 158 | 158 | 1.0000 | 1.0000 | 1.0000 | 1.10e-115 | |
2 | 3hee:A | 148 | 151 | 0.3291 | 0.3514 | 0.3444 | 1.22e-27 | 3hee:B, 3ph3:A, 3ph3:B, 3ph4:A, 3ph4:B |
3 | 3k7p:A | 153 | 110 | 0.2025 | 0.2092 | 0.2909 | 5.43e-18 | 3k7p:B, 3k7s:A, 3k7s:B, 3k7s:C, 3k7s:D, 3k8c:A, 3k8c:B, 3m1p:A, 3m1p:B |
4 | 4lfl:B | 172 | 120 | 0.2215 | 0.2035 | 0.2917 | 5.58e-12 | 4lfl:D, 4lfm:B, 4lfm:D, 4lfn:B, 4lfn:D |
5 | 6mu0:A | 152 | 153 | 0.2658 | 0.2763 | 0.2745 | 1.20e-11 | |
6 | 2bes:C | 158 | 152 | 0.2468 | 0.2468 | 0.2566 | 1.69e-07 | 2bes:A, 2bes:B, 2bes:D, 2bes:E, 2bet:A, 2bet:B, 2bet:C, 2bet:D, 2bet:E, 1usl:A, 1usl:B, 1usl:C, 1usl:D, 1usl:E, 2vvo:A, 2vvo:B, 2vvo:C, 2vvo:D, 2vvo:E, 2vvp:A, 2vvp:B, 2vvp:C, 2vvp:D, 2vvp:E, 2vvq:A, 2vvq:B, 2vvq:C, 2vvq:D, 2vvq:E |
7 | 3t7s:A | 246 | 91 | 0.1772 | 0.1138 | 0.3077 | 0.17 | 3t7s:B, 3t7s:C, 3t7s:D, 3t7t:A, 3t7t:B, 3t7t:C, 3t7t:D |
8 | 4lfl:A | 142 | 127 | 0.1582 | 0.1761 | 0.1969 | 0.19 | 4lfl:C, 4lfm:A, 4lfm:C, 4lfn:A, 4lfn:C |
9 | 5mmi:I | 137 | 61 | 0.1076 | 0.1241 | 0.2787 | 3.6 | 5mmm:I |
10 | 7pvn:B | 990 | 23 | 0.0886 | 0.0141 | 0.6087 | 5.0 | 7sol:C |
11 | 7sol:A | 1011 | 23 | 0.0886 | 0.0138 | 0.6087 | 5.2 | 7pvn:A |
12 | 6yxx:E2 | 369 | 26 | 0.0696 | 0.0298 | 0.4231 | 5.8 | |
13 | 6tg3:D | 327 | 19 | 0.0759 | 0.0367 | 0.6316 | 5.8 | 5l9g:A, 5l9g:B, 5l9i:A, 5l9i:B, 5l9l:A, 5l9l:B, 6tg2:A, 6tg2:B, 6tg2:C, 6tg2:D, 6tg3:A, 6tg3:B, 6tg3:C |
14 | 1yqq:A | 273 | 58 | 0.1266 | 0.0733 | 0.3448 | 6.1 | 1yqq:B, 1yqq:C, 1yqu:A, 1yqu:B, 1yqu:C, 1yr3:A, 1yr3:B, 1yr3:C, 1yr3:D, 1yr3:E, 1yr3:F |
15 | 7yi2:A | 506 | 36 | 0.0759 | 0.0237 | 0.3333 | 7.4 | 7yi5:A |
16 | 6dc6:C | 996 | 33 | 0.0949 | 0.0151 | 0.4545 | 7.9 | 6dc6:A, 1z7l:A, 1z7l:B, 1z7l:C |