LPNGVAIFKCTVPNTIALTFDDGPHIWTENAVNQLEAAGMKGTFFLNGKNFGELKNYVPLLKRMRANRHQIGSHTWDHPY
LTQLSDAAVRKQMTDFENELRRLIGYYPTYMRPPYFDYNAKTLAVMKELGYRVIHADLDTNDWKFDMPASIAAFKAGVAN
NRIVLAHDVHETTVKTLLPAMIKEVQRLKLKAVTVGECLGEPYAYWYRVTPR
The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hfa:A | 212 | 212 | 1.0000 | 1.0000 | 1.0000 | 3.96e-162 | 8hfa:B, 8hfa:C, 8hfa:D, 8hfa:E |
2 | 7bly:A | 216 | 214 | 0.4340 | 0.4259 | 0.4299 | 1.28e-55 | |
3 | 2y8u:B | 212 | 213 | 0.4198 | 0.4198 | 0.4178 | 4.33e-50 | 2y8u:A |
4 | 2iw0:A | 226 | 220 | 0.4151 | 0.3894 | 0.4000 | 3.66e-49 | |
5 | 8he1:A | 225 | 206 | 0.3491 | 0.3289 | 0.3592 | 6.58e-39 | 8he2:A, 8he4:A, 8hf9:A |
6 | 2c1g:A | 384 | 186 | 0.3396 | 0.1875 | 0.3871 | 4.20e-30 | 2c1i:A |
7 | 5o6y:A | 214 | 179 | 0.2689 | 0.2664 | 0.3184 | 2.57e-23 | 5o6y:B, 5o6y:C, 5o6y:D |
8 | 6h8l:B | 206 | 185 | 0.2877 | 0.2961 | 0.3297 | 4.27e-22 | 6h8l:A, 6h8n:A, 6h8n:B |
9 | 2cc0:A | 192 | 182 | 0.2406 | 0.2656 | 0.2802 | 2.03e-19 | 2cc0:B |
10 | 5n1j:A | 206 | 203 | 0.2783 | 0.2864 | 0.2906 | 7.51e-19 | 5n1j:B, 5n1j:C, 5n1j:D, 5n1p:A, 5n1p:D, 5n1p:B, 5n1p:C, 5nc6:A, 5nc6:B, 5nc6:C, 5nc6:D, 5nc9:A, 5nc9:B, 5nc9:C, 5nc9:D, 5ncd:A, 5ncd:B, 5ncd:C, 5ncd:D, 5nek:A, 5nek:B, 5nek:C, 5nek:D, 5nel:A, 5nel:B, 5nel:C, 5nel:D |
11 | 2j13:A | 207 | 166 | 0.2547 | 0.2609 | 0.3253 | 2.94e-18 | |
12 | 2c71:A | 205 | 161 | 0.2264 | 0.2341 | 0.2981 | 2.35e-17 | 2c79:A |
13 | 7ax7:A | 205 | 191 | 0.2547 | 0.2634 | 0.2827 | 7.21e-16 | |
14 | 5jp6:A | 339 | 190 | 0.2217 | 0.1386 | 0.2474 | 1.36e-08 | |
15 | 3rxz:C | 287 | 119 | 0.1368 | 0.1010 | 0.2437 | 4.47e-04 | 3rxz:A, 3rxz:B, 3rxz:D |
16 | 4nyu:A | 406 | 69 | 0.1038 | 0.0542 | 0.3188 | 0.002 | 4ny2:A, 4ny2:B, 4nyy:A, 4nyy:B, 4nyy:C, 4nyy:D, 4nz1:A, 4nz1:B, 4nz3:A, 4nz3:B, 4nz4:A, 4nz4:B, 4oui:A, 4oui:B |
17 | 2w3z:A | 238 | 193 | 0.2311 | 0.2059 | 0.2539 | 0.002 | |
18 | 5jmu:A | 220 | 180 | 0.2028 | 0.1955 | 0.2389 | 0.002 | |
19 | 3wx7:A | 402 | 69 | 0.0991 | 0.0522 | 0.3043 | 0.020 | 3wx7:B |
20 | 2vyo:A | 206 | 204 | 0.2358 | 0.2427 | 0.2451 | 0.16 | |
21 | 4y7e:A | 302 | 67 | 0.0943 | 0.0662 | 0.2985 | 0.33 | 4y7e:B |
22 | 6dq3:A | 227 | 73 | 0.0896 | 0.0837 | 0.2603 | 0.42 | 6dq3:B |
23 | 6d50:B | 840 | 31 | 0.0660 | 0.0167 | 0.4516 | 0.83 | 6d50:A, 6nzg:A, 6nzg:B, 5uj6:A, 5uj6:B |
24 | 6f0x:B | 398 | 32 | 0.0660 | 0.0352 | 0.4375 | 3.1 | 6f0x:A, 6f0x:C, 6f0x:D, 6f0x:E, 7l9p:A, 7l9p:B, 7l9p:C, 7l9p:D, 7l9p:E |
25 | 5vqa:A | 368 | 32 | 0.0660 | 0.0380 | 0.4375 | 3.3 | 5wc2:A |
26 | 2vs4:A | 288 | 48 | 0.0708 | 0.0521 | 0.3125 | 3.6 | 1g8o:A, 1g93:A, 1gwv:A, 1gwv:B, 1gww:A, 1gww:B, 1gx0:A, 1gx0:B, 1gx4:A, 1gx4:B, 2jcj:A, 2jck:A, 1k4v:A, 1k4v:B, 5nrb:A, 5nrb:B, 5nrd:A, 5nrd:B, 5nre:A, 1o7o:A, 1o7o:B, 1o7q:A, 1o7q:B, 2vfz:A, 2vfz:B, 2vs3:A, 2vs3:B, 2vs4:B, 2vs5:A, 2vs5:B, 2vxl:A, 1vzt:A, 1vzt:B, 1vzu:A, 1vzu:B, 1vzx:A, 1vzx:B, 2wgz:A, 2wgz:B |
27 | 7kx9:A | 734 | 127 | 0.1462 | 0.0422 | 0.2441 | 4.3 | 7kx7:A, 7yfq:A, 7yg6:A |
28 | 7v02:F | 650 | 43 | 0.0660 | 0.0215 | 0.3256 | 5.8 | |
29 | 7v00:F | 695 | 43 | 0.0660 | 0.0201 | 0.3256 | 6.0 | 7v01:F |
30 | 3hkz:A | 836 | 51 | 0.0566 | 0.0144 | 0.2353 | 6.4 | 3hkz:I, 2y0s:A, 2y0s:W |
31 | 7ela:A | 1402 | 76 | 0.0991 | 0.0150 | 0.2763 | 6.5 |