BioLiP

>protein
LPILGVLGGMGPVVTAEFLKSIYEYNPFIDKEQESPNVIVFSFPSAPDRTGSIDSGKEREFIDFIQVNLEHLNKLADCIV
IGSCTAHYALPQIPENLKDKLISLIKIADQELQEYNEPTLLLASTGTYQKKLFQEGCTTADLIISLSESDQKLIHEMIYK
VLKRGHDPLSILRDIEALLEKYNTRSYISGSTEFHLLTKSLKLKGIDSIKAIDPLSTIAQNFSQLII

The query sequence (length=227) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5wxy:A	227	227	1.0000	1.0000	1.0000	4.17e-167	5wxz:A, 5xni:A, 5xnj:A, 5xnk:A
2	2dx7:A	228	227	0.3216	0.3202	0.3216	6.04e-22
3	3s7z:B	235	222	0.2996	0.2894	0.3063	6.31e-18
4	7byi:A	463	45	0.0661	0.0324	0.3333	0.80	8aql:A, 8aql:B, 8aql:C, 8aql:D, 9box:A, 9box:C, 9box:B, 9box:D, 7byi:B, 8fjt:A, 8fjt:B, 8fju:A, 8fju:B, 8gks:A, 8gks:B, 8gkt:A, 8gkt:B, 8gku:A, 8gku:B, 8gkw:A, 8gkw:B, 8gky:A, 8gky:B, 8gkz:A, 8gkz:B, 6m5o:A, 6m5o:B, 6qvg:A, 6qvg:B, 6qvl:A, 6qvl:B, 8t4o:A, 8t4o:B, 8t4p:A, 8t4p:B, 8tlc:A, 8tlc:B, 5v7i:A, 5v7i:B
5	1zru:C	254	71	0.1057	0.0945	0.3380	1.8	1zru:A, 1zru:B
6	1sgl:A	206	22	0.0441	0.0485	0.4545	2.3
7	7xn7:V	106	27	0.0396	0.0849	0.3333	3.1	6ir9:V, 6j4w:V, 6j4x:V, 6j4y:V, 6j4z:V, 6j50:V, 6j51:V, 8jh2:V, 7wbv:V, 7wbw:V, 7wbx:V, 5xon:V, 7xse:V, 7xsx:V, 7xsz:V, 7xt7:V, 7xtd:V, 7xti:V
8	5o25:B	323	34	0.0617	0.0433	0.4118	3.4	5o1u:A, 5o1u:B, 5o25:A, 5o4z:A, 5o58:A, 5o70:A, 5o7f:A, 5o7f:B
9	8ye9:B	89	36	0.0529	0.1348	0.3333	3.7
10	6q7i:A	770	97	0.1145	0.0338	0.2680	3.9	6q7j:A, 6q7j:B
11	7btb:m	469	67	0.0881	0.0426	0.2985	5.2	7bt6:m, 6ft6:m, 3jct:m, 6m62:m, 7oh3:m, 7ohq:m, 7oht:m, 7ug6:m, 7uoo:m, 7uqb:m, 7uqz:m, 7uui:m, 7v08:m, 6ylg:m, 6ylh:m
12	6smn:D	480	55	0.0837	0.0396	0.3455	6.1	6smn:A, 6smn:B, 6smn:C, 6smw:A, 6smw:B, 6smw:C, 6smw:D
13	3q87:B	164	68	0.1013	0.1402	0.3382	7.4

[Back]