LNPSLVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGVTHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHI
VAYYILATSSNGYDPKF
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7wg5:AG | 99 | 97 | 0.9381 | 0.9192 | 0.9381 | 4.35e-64 | 7dkz:G, 8j6z:G, 8j7a:G, 8j7b:G, 5l8r:G, 7wfd:AG, 7wfe:BG, 7wg5:BG, 6yac:G, 6yez:G, 6zoo:G, 6zxs:G |
2 | 8wgh:G | 98 | 97 | 0.9072 | 0.8980 | 0.9072 | 1.79e-60 | |
3 | 3lw5:G | 95 | 94 | 0.8969 | 0.9158 | 0.9255 | 2.89e-60 | 6igz:G, 2o01:G, 2wsc:G, 2wse:G, 2wsf:G, 4xk8:G, 4xk8:g |
4 | 5zji:G | 97 | 97 | 0.8351 | 0.8351 | 0.8351 | 7.98e-56 | |
5 | 8bcv:G | 94 | 95 | 0.8351 | 0.8617 | 0.8526 | 2.11e-55 | |
6 | 4y28:G | 91 | 95 | 0.8454 | 0.9011 | 0.8632 | 1.04e-54 | |
7 | 6l35:G | 98 | 96 | 0.6701 | 0.6633 | 0.6771 | 1.56e-46 | 8htu:G, 7ksq:G, 7kux:G, 7xqp:G |
8 | 4rku:G | 84 | 89 | 0.7216 | 0.8333 | 0.7865 | 5.42e-41 | |
9 | 7a4p:G | 99 | 91 | 0.5361 | 0.5253 | 0.5714 | 5.60e-35 | 6zzx:G, 6zzy:G |
10 | 7yca:G | 95 | 87 | 0.4948 | 0.5053 | 0.5517 | 4.48e-32 | |
11 | 7zq9:G | 95 | 92 | 0.3814 | 0.3895 | 0.4022 | 5.81e-18 | 7d0j:G, 7dz7:G, 7dz8:G, 8h2u:G, 7zqd:G, 7zqd:G2 |
12 | 7zqc:G | 80 | 90 | 0.3711 | 0.4500 | 0.4000 | 1.22e-15 | 7bgi:G, 7blx:G, 6jo5:G, 6jo6:G |
13 | 8cmo:G | 93 | 93 | 0.3402 | 0.3548 | 0.3548 | 3.67e-15 | |
14 | 6ijo:G | 70 | 90 | 0.3299 | 0.4571 | 0.3556 | 1.08e-13 | 7r3k:G |
15 | 6sl5:G | 101 | 96 | 0.3608 | 0.3465 | 0.3646 | 8.83e-08 | |
16 | 7a4p:K | 86 | 81 | 0.3093 | 0.3488 | 0.3704 | 5.87e-07 | 6zzx:K, 6zzy:K |
17 | 6igz:K | 80 | 85 | 0.3093 | 0.3750 | 0.3529 | 1.60e-06 | |
18 | 8j6z:K | 84 | 85 | 0.2887 | 0.3333 | 0.3294 | 1.26e-05 | 7dkz:K, 8j7b:K, 5l8r:K, 4rku:K, 6yac:K, 6yez:K, 6zoo:K, 6zxs:K |
19 | 8htu:K | 81 | 83 | 0.2577 | 0.3086 | 0.3012 | 3.27e-05 | 7ksq:K, 7kux:K, 6l35:K, 7xqp:K |
20 | 8bcv:K | 88 | 85 | 0.2887 | 0.3182 | 0.3294 | 4.89e-05 | 7ew6:K, 7ewk:K, 7f9o:K, 7f9o:n, 2wse:K, 5zji:K |
21 | 8cmo:K | 89 | 29 | 0.1649 | 0.1798 | 0.5517 | 1.90e-04 | |
22 | 8wgh:K | 83 | 83 | 0.2680 | 0.3133 | 0.3133 | 2.77e-04 | |
23 | 7wfd:AK | 65 | 29 | 0.1237 | 0.1846 | 0.4138 | 3.87e-04 | 7wfe:BK, 7wg5:AK, 7wg5:BK |
24 | 7dz7:K | 86 | 20 | 0.1546 | 0.1744 | 0.7500 | 4.34e-04 | 7bgi:K, 7blx:K, 7d0j:K, 7dz8:K, 6ijj:K, 6ijo:K, 7r3k:K, 7zq9:K, 7zqc:K, 7zqd:K, 7zqd:K2 |
25 | 8j7a:K | 56 | 26 | 0.1134 | 0.1964 | 0.4231 | 0.006 | |
26 | 7yca:K | 87 | 31 | 0.1753 | 0.1954 | 0.5484 | 0.11 | |
27 | 6sl5:K | 84 | 73 | 0.2474 | 0.2857 | 0.3288 | 0.16 | |
28 | 8wm6:K | 69 | 31 | 0.1443 | 0.2029 | 0.4516 | 1.8 | 8wmj:K, 8wmv:K, 8wmw:K |
29 | 4xk8:k | 46 | 17 | 0.0928 | 0.1957 | 0.5294 | 2.6 | 4xk8:K |
30 | 8b4l:C | 311 | 19 | 0.0928 | 0.0289 | 0.4737 | 3.1 | 8b4l:E, 8b4l:A, 8b4l:B, 8b4l:D, 8b4l:F, 8b4m:B, 8b4m:D, 8b4m:E, 8b4m:F |
31 | 2cks:B | 306 | 52 | 0.1546 | 0.0490 | 0.2885 | 3.2 | 2ckr:B, 2ckr:A, 2cks:A |
32 | 6et3:B | 275 | 75 | 0.2371 | 0.0836 | 0.3067 | 3.7 | |
33 | 4a42:A | 127 | 14 | 0.1031 | 0.0787 | 0.7143 | 5.2 | 4a42:B |
34 | 5odn:D | 106 | 28 | 0.1031 | 0.0943 | 0.3571 | 6.3 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
35 | 6jl2:A | 401 | 50 | 0.1856 | 0.0449 | 0.3600 | 7.5 | 6jkz:A, 6jl2:B, 6jl2:C |
36 | 2xj9:A | 265 | 59 | 0.1649 | 0.0604 | 0.2712 | 8.8 | 2xj9:B |