LNGLTSYFENGRARVVPPVGRNILGVVNYASVCEYPTLDHGYPELEINMVAPTAEPFAEVWVTDAESEHGERDGITYAHD
GEYFFCAGRVPPTGRYTEATRAAYVTMFELLEEFGYSSVFRMWNFIGDINRDNAEGMEVYRDFCRGRAEAFEQCRLEFDQ
FPAATGIGSRGGGIAFYLLACRSGGHVHIENPRQVPAYHYPKRYGPRAPRFARATYLPSRAADGVGGQVFVSGTASVLGH
ETAHEGDLVKQCRLALENIELVISGGNLAAHGISAGHGLTALRNIKVYVRRSEDVPAVREICREAFSPDADIVYLTVDVS
RSDLLVEIEGVVM
The query sequence (length=333) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5a3k:A | 335 | 333 | 1.0000 | 0.9940 | 1.0000 | 0.0 | 5a3k:B, 5a3k:C, 5ag3:A, 5ag3:B |
| 2 | 4bps:A | 331 | 312 | 0.4054 | 0.4079 | 0.4327 | 3.31e-86 | |
| 3 | 5d73:A | 207 | 37 | 0.0390 | 0.0628 | 0.3514 | 2.4 | 5d73:B |
| 4 | 7ana:AAA | 475 | 45 | 0.0450 | 0.0316 | 0.3333 | 3.1 | 7ana:BBB, 7anb:AAA, 7anb:BBB |
| 5 | 3d1k:B | 146 | 24 | 0.0390 | 0.0890 | 0.5417 | 3.3 | 4g51:B, 4g51:D, 3gkv:B, 3gqg:B, 3gqg:D, 2h8d:B, 2h8d:D, 2h8f:B, 2h8f:D, 1hbh:B, 1hbh:D, 4iro:B, 4iro:D, 1la6:B, 5lfg:B, 5lfg:D, 3nfe:B, 3nfe:D, 3ng6:B, 3ng6:D, 4odc:B, 1pbx:B, 2peg:B, 1s5x:B, 1s5y:B, 1s5y:D, 1t1n:B |
| 6 | 7rbw:A | 381 | 50 | 0.0330 | 0.0289 | 0.2200 | 5.2 | 7rbw:B |
| 7 | 3o6d:A | 259 | 72 | 0.0661 | 0.0849 | 0.3056 | 7.7 | |
| 8 | 5cqg:A | 596 | 55 | 0.0450 | 0.0252 | 0.2727 | 7.8 | 5cqg:B, 6e53:A, 7kqm:A, 7kqn:A, 7kqn:D, 3kyl:A, 6uso:A, 6usp:A, 6usq:A, 6usr:A |
umich.edu