LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYT
ISPDIDCSRIY
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3gsh:A | 91 | 91 | 1.0000 | 1.0000 | 1.0000 | 2.62e-63 | 3gsh:B, 1jtb:A, 1mid:A |
2 | 1bwo:A | 90 | 90 | 0.7143 | 0.7222 | 0.7222 | 1.74e-45 | 1bwo:B, 1cz2:A |
3 | 1rzl:A | 91 | 90 | 0.6264 | 0.6264 | 0.6333 | 7.44e-39 | 1uvc:A, 1uvc:B |
4 | 1fk6:A | 93 | 91 | 0.5604 | 0.5484 | 0.5604 | 1.00e-33 | 1fk7:A |
5 | 5lqv:A | 93 | 90 | 0.5165 | 0.5054 | 0.5222 | 1.95e-30 | |
6 | 6iwo:A | 92 | 90 | 0.4176 | 0.4130 | 0.4222 | 1.74e-20 | 6iwo:B, 6iwp:A, 5tvi:W, 7w9a:A |
7 | 1qf9:A | 194 | 38 | 0.1758 | 0.0825 | 0.4211 | 0.20 | 1uke:A, 2ukd:A, 3ukd:A, 4ukd:A, 5ukd:A |
8 | 1n89:A | 67 | 25 | 0.1099 | 0.1493 | 0.4000 | 3.6 | 1tuk:A |
9 | 2vzs:A | 857 | 41 | 0.1648 | 0.0175 | 0.3659 | 6.6 | 2vzs:B, 2vzt:A, 2vzt:B, 2vzu:A, 2vzu:B, 2vzv:A, 2vzv:B, 2x05:A, 2x05:B, 2x09:A, 2x09:B |
10 | 6aon:A | 473 | 12 | 0.0879 | 0.0169 | 0.6667 | 7.3 | 6aon:B |
11 | 8iuf:A9 | 484 | 53 | 0.1648 | 0.0310 | 0.2830 | 9.6 | 8j9h:A9, 8j9i:A9, 8j9j:A9 |