BioLiP

>protein
LLQYHYDCGDFGMQLLAYPTRGRTVHFKVLDEFGTRFEVANCSICMHWLNTGEDGGLIFSAGYEGCHVLVKDGRYVLRVQ
LEEMLLSGVVAASYEVQMTCPRP

The query sequence (length=103) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6gf7:A	105	103	1.0000	0.9810	1.0000	6.04e-75	6gf7:B
2	3e5z:A	290	25	0.1165	0.0414	0.4800	1.2	3e5z:B
3	7u5y:A	227	70	0.1845	0.0837	0.2714	1.7	7u5y:B, 7u5y:C, 7u5y:D, 7u5y:E, 7u5y:F
4	7qxb:P	251	50	0.1262	0.0518	0.2600	3.1	7qxs:P
5	7w12:A	490	38	0.1359	0.0286	0.3684	3.2
6	1l5j:A	862	35	0.1068	0.0128	0.3143	3.8	1l5j:B
7	8k9n:A	125	24	0.0874	0.0720	0.3750	4.3	8k9p:A, 3nyk:A, 2p80:D, 1paz:A, 3paz:A, 4paz:A, 5paz:A, 6paz:A, 7paz:A, 8paz:A, 1py0:A, 1pza:A, 1pzb:A, 4rh4:A, 5x31:A, 5x31:B
8	2h1i:A	212	22	0.0874	0.0425	0.4091	5.4	2h1i:B, 2h1i:C
9	5u6n:B	448	25	0.0874	0.0201	0.3600	5.7	5u6m:A, 5u6m:B, 5u6n:A, 5u6s:A, 5u6s:B, 5v2j:A, 5v2j:B, 5v2k:A, 5v2k:B
10	3j3v:C	277	52	0.2039	0.0758	0.4038	6.0	7aqc:C, 7aqd:C, 7as8:E, 7as9:E, 8buu:C, 6ha1:C, 6ha8:C, 6htq:C, 3j3w:C, 3j9w:BD, 5njt:W, 7o5b:Z, 7ope:E, 6ppf:C, 6ppk:C, 6pvk:C, 8qcq:C, 7qgu:C, 7qh4:C, 8qpp:Z, 7qv1:C, 7qv2:C, 7qv3:C, 8r55:Z, 8s1p:C, 8s1u:C, 7s9u:C, 7sae:C, 6tnn:W, 6tpq:W
11	6o8w:C	275	29	0.1359	0.0509	0.4828	6.1	7nhk:G, 6o8x:C, 6o8y:C, 6o8z:C, 6o90:C, 7p7q:G, 7p7r:G, 7p7s:G, 7p7t:G, 7p7u:G, 6w6p:C
12	1rpx:A	230	58	0.1553	0.0696	0.2759	6.2	1rpx:B, 1rpx:C
13	4rhm:A	308	26	0.1262	0.0422	0.5000	8.6	4rhl:A, 4rhl:B, 4rhm:B, 4rhm:C
14	6yxx:EN	638	75	0.2136	0.0345	0.2933	8.6	6yxy:EN

[Back]