LKGLRRLVLDVLKPHEPKTIVFALKLSELENVDGVNIHLSEIDQATENIKITILGNNLDYEQIKGVIEDMGGVIHSVDEV
VAGKIIVESV
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3bpd:F | 92 | 90 | 1.0000 | 0.9783 | 1.0000 | 6.90e-59 | 3bpd:A, 3bpd:H, 3bpd:B, 3bpd:I, 3bpd:C, 3bpd:J, 3bpd:D, 3bpd:K, 3bpd:E, 3bpd:L, 3bpd:M, 3bpd:G, 3bpd:N |
2 | 2raq:B | 94 | 89 | 0.6222 | 0.5957 | 0.6292 | 2.25e-32 | 2raq:A, 2raq:E, 2raq:F |
3 | 6mo6:B | 414 | 44 | 0.1889 | 0.0411 | 0.3864 | 0.53 | 8dhk:A, 8dhk:B, 6mo6:A, 6mo6:C, 6mo6:D, 6mp5:A, 6mp5:B, 6mp5:C, 6mp5:D, 6oi5:A, 6oi5:B, 6oi6:A, 6oi6:B, 6oib:A, 6oib:B, 6oic:A, 6oic:B, 6wh6:A, 6wh6:B |
4 | 2r72:A | 765 | 21 | 0.1222 | 0.0144 | 0.5238 | 1.2 | |
5 | 6nbr:A | 316 | 47 | 0.1667 | 0.0475 | 0.3191 | 1.4 | 6nbr:B, 6nbr:C, 6nbr:D |
6 | 4r1s:A | 319 | 48 | 0.1667 | 0.0470 | 0.3125 | 2.2 | 4r1s:B |
7 | 6zvp:D | 458 | 30 | 0.1444 | 0.0284 | 0.4333 | 2.3 | 7a2g:A, 7a2g:B, 7a2g:C, 7a2g:D, 7pim:B, 7pim:A, 7pim:D, 7pim:F, 1toh:A, 2toh:A, 2xsn:A, 2xsn:B, 2xsn:C, 2xsn:D, 6zn2:A, 6zn2:C, 6zn2:E, 6zn2:G, 6zvp:A, 6zvp:B, 6zvp:C, 6zzu:B, 6zzu:A, 6zzu:C, 6zzu:D |
8 | 5mog:B | 472 | 32 | 0.1333 | 0.0254 | 0.3750 | 4.8 | 5mog:A, 5mog:C, 5mog:D, 5mog:E |
9 | 7cgu:A | 352 | 21 | 0.1111 | 0.0284 | 0.4762 | 6.3 | |
10 | 4aij:B | 142 | 60 | 0.2111 | 0.1338 | 0.3167 | 6.4 | 4aij:A, 4aik:A |
11 | 4a4a:A | 886 | 24 | 0.1111 | 0.0113 | 0.4167 | 6.6 | 7mfk:A, 7mfl:A, 2vc9:A, 2vca:A, 2vcb:A, 2vcc:A |
12 | 6r5i:A | 733 | 41 | 0.1556 | 0.0191 | 0.3415 | 9.2 | 6r5i:B, 6r5n:B, 6r5n:A, 6r5o:B, 6r5o:A, 6r5p:B, 6r5p:A, 6r5r:B, 6r5r:A, 6r5t:B, 6r5t:A, 6r5u:B, 6r5u:A, 6r5v:B, 6r5v:A |