BioLiP

>protein
LKGLRRLVLDVLKPHEPKTIVFALKLSELENVDGVNIHLSEIDQATENIKITILGNNLDYEQIKGVIEDMGGVIHSVDEV
VAGKIIVESV

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3bpd:F	92	90	1.0000	0.9783	1.0000	6.90e-59	3bpd:A, 3bpd:H, 3bpd:B, 3bpd:I, 3bpd:C, 3bpd:J, 3bpd:D, 3bpd:K, 3bpd:E, 3bpd:L, 3bpd:M, 3bpd:G, 3bpd:N
2	2raq:B	94	89	0.6222	0.5957	0.6292	2.25e-32	2raq:A, 2raq:E, 2raq:F
3	6mo6:B	414	44	0.1889	0.0411	0.3864	0.53	8dhk:A, 8dhk:B, 6mo6:A, 6mo6:C, 6mo6:D, 6mp5:A, 6mp5:B, 6mp5:C, 6mp5:D, 6oi5:A, 6oi5:B, 6oi6:A, 6oi6:B, 6oib:A, 6oib:B, 6oic:A, 6oic:B, 6wh6:A, 6wh6:B
4	2r72:A	765	21	0.1222	0.0144	0.5238	1.2
5	6nbr:A	316	47	0.1667	0.0475	0.3191	1.4	6nbr:B, 6nbr:C, 6nbr:D
6	4r1s:A	319	48	0.1667	0.0470	0.3125	2.2	4r1s:B
7	6zvp:D	458	30	0.1444	0.0284	0.4333	2.3	7a2g:A, 7a2g:B, 7a2g:C, 7a2g:D, 7pim:B, 7pim:A, 7pim:D, 7pim:F, 1toh:A, 2toh:A, 2xsn:A, 2xsn:B, 2xsn:C, 2xsn:D, 6zn2:A, 6zn2:C, 6zn2:E, 6zn2:G, 6zvp:A, 6zvp:B, 6zvp:C, 6zzu:B, 6zzu:A, 6zzu:C, 6zzu:D
8	5mog:B	472	32	0.1333	0.0254	0.3750	4.8	5mog:A, 5mog:C, 5mog:D, 5mog:E
9	7cgu:A	352	21	0.1111	0.0284	0.4762	6.3
10	4aij:B	142	60	0.2111	0.1338	0.3167	6.4	4aij:A, 4aik:A
11	4a4a:A	886	24	0.1111	0.0113	0.4167	6.6	7mfk:A, 7mfl:A, 2vc9:A, 2vca:A, 2vcb:A, 2vcc:A
12	6r5i:A	733	41	0.1556	0.0191	0.3415	9.2	6r5i:B, 6r5n:B, 6r5n:A, 6r5o:B, 6r5o:A, 6r5p:B, 6r5p:A, 6r5r:B, 6r5r:A, 6r5t:B, 6r5t:A, 6r5u:B, 6r5u:A, 6r5v:B, 6r5v:A

[Back]