BioLiP

>protein
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN

The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2bhi:A	60	60	1.0000	1.0000	1.0000	4.85e-38	2bhi:B, 1h0j:A, 1h0j:B, 1h0j:C, 1xt3:A
2	7c28:A	65	53	0.3667	0.3385	0.4151	1.58e-07	7c28:B
3	8vy8:B	75	58	0.3833	0.3067	0.3966	2.01e-06	1abt:A, 2btx:A, 1bxp:A, 1haa:A, 1haj:A, 5hbv:A, 1hc9:A, 1hc9:B, 1hoy:A, 1idg:A, 1idh:A, 1jbd:A, 1kc4:A, 1kl8:A, 1l4w:A, 1ljz:A, 2qc1:A, 1rgj:A, 6uwz:G, 8vy8:A, 8vy8:E, 8vy8:G
4	5mg9:A	65	61	0.3500	0.3231	0.3443	4.45e-06
5	8we8:B	60	54	0.3500	0.3500	0.3889	3.01e-04
6	1v6p:A	62	47	0.2833	0.2742	0.3617	0.004	1v6p:B
7	5ebx:A	62	53	0.2833	0.2742	0.3208	0.028	6ebx:B
8	9avv:G	62	53	0.3333	0.3226	0.3774	0.028	9avv:F, 9awk:F, 9awk:G
9	1lxg:A	71	64	0.3667	0.3099	0.3438	0.22	1lxh:A, 7pc0:K, 6zfm:A, 6zfm:B, 6zfm:D, 6zfm:E
10	5erl:D	258	22	0.2000	0.0465	0.5455	0.53	5ep9:A, 5ep9:B, 5ep9:C, 5ep9:D, 5equ:A, 5equ:B, 5equ:C, 5equ:D, 5erl:A, 5erl:B, 5erl:C
11	7rd6:A	929	23	0.1833	0.0118	0.4783	1.6	7rd7:A, 7rd8:A
12	5epa:A	258	21	0.1667	0.0388	0.4762	1.7	5epa:B, 5epa:C, 5epa:D, 5epa:E, 5epa:F
13	3jb9:B	904	38	0.1833	0.0122	0.2895	3.8
14	8c07:B	450	27	0.1833	0.0244	0.4074	6.6

[Back]