BioLiP

>protein
LKASSLRALKLMHLATSANDDDTDEKVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDD
IDIALAETRAAIAYGADSVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLAVIIETGELKDEALIRKASEISIKAG
ADNIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPVGGVRTAEDAQKYLAIADELFGADWADARHYAFGASASLL
ASLLKALGH

The query sequence (length=249) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1jcj:A	252	234	0.8675	0.8571	0.9231	2.18e-145	5eky:A, 5el1:A, 5emu:A, 8for:A, 8for:B, 8for:C, 8for:D, 8for:E, 8for:F, 1jcj:B, 1jcl:A, 1jcl:B, 7p76:A, 7p76:B, 7p76:C, 7p76:D, 7p76:E, 7p76:F, 7p76:G, 7p76:H, 7p76:I, 7p76:J, 7p76:K, 7p76:L, 3q2d:A, 3q2d:B, 6z9i:B
2	3ngj:D	222	194	0.2329	0.2613	0.2990	4.63e-14	3ngj:A, 3ngj:B, 3ngj:C
3	3qyq:A	273	234	0.2691	0.2454	0.2863	4.47e-11	3qyq:B
4	1ub3:A	211	149	0.1968	0.2322	0.3289	6.51e-09	1ub3:B, 1ub3:C, 1ub3:D
5	3i4l:A	524	61	0.0803	0.0382	0.3279	3.8	3i73:A
6	8r9t:A	33	33	0.0522	0.3939	0.3939	4.3
7	1ewy:A	303	30	0.0442	0.0363	0.3667	4.9	1b2r:A, 1bjk:A, 2bmw:A, 4bpr:A, 1bqe:A, 2bsa:A, 4c43:A, 1e62:A, 1e63:A, 1e64:A, 1ewy:B, 1gjr:A, 1go2:A, 1gr1:A, 1h42:A, 1h85:A, 1ogi:A, 1ogj:A, 1qgy:A, 1qgz:A, 1qh0:A, 1que:A, 1quf:A, 2vyq:A, 2vzl:A, 1w34:A, 1w35:A, 1w87:A, 1w87:B, 2x3u:A, 3zbt:A, 3zbu:A, 3zc3:A, 3zc3:B
8	5c1s:A	288	53	0.0643	0.0556	0.3019	7.4	5c1s:B, 5c1t:A, 5c1t:B
9	1g5c:A	169	61	0.0723	0.1065	0.2951	8.4	1g5c:B, 1g5c:C, 1g5c:D, 1g5c:E, 1g5c:F
10	6qud:A	837	28	0.0482	0.0143	0.4286	9.4
11	6xfr:B	216	51	0.0522	0.0602	0.2549	9.6	6xfr:A
12	8iau:H	412	30	0.0482	0.0291	0.4000	9.7
13	7nit:D	1253	31	0.0482	0.0096	0.3871	9.8	5dmy:A, 5dmy:B, 5dmy:C, 7nit:A, 7nit:B, 7nit:C, 7nit:E, 7nit:F, 6qub:A, 6qub:B, 6quc:A, 6quc:B

[Back]