LIHLDPVPSFEDRHEIKPWLQKIFYPQGIDIVIERSDSSKVTFKCRSACPFRIRAAYSVRLQKWNVVVMNNIHSHELRFD
The query sequence (length=120) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # |
Hit |
Hit
length |
Aligned
length |
Identity
(normalized by query) |
Identity
(normalized by hit) |
Identity (normalized
by aligned length) |
E-value |
Homologs
to hit |
| 1 |
4lmg:B |
121 |
121 |
1.0000 |
0.9917 |
0.9917 |
1.91e-85 |
4lmg:A, 4lmg:C, 4lmg:D |
| 2 |
6jgz:B |
3485 |
69 |
0.1583 |
0.0055 |
0.2754 |
0.57 |
6jg3:A, 6jg3:B, 6jg3:C, 6jg3:D, 6jgz:D, 6jgz:F, 6jgz:H, 6jh6:B, 6jh6:D, 6jh6:F, 6jh6:H, 6jhn:A, 6jhn:C, 6jhn:E, 6jhn:G, 6ji0:A, 6ji0:C, 6ji0:E, 6ji0:G, 6jrr:A, 6jrr:C, 6jrr:E, 6jrr:G |
| 3 |
6jiy:A |
3521 |
69 |
0.1583 |
0.0054 |
0.2754 |
0.57 |
6ji8:A, 6ji8:D, 6ji8:G, 6ji8:J, 6jii:B, 6jii:E, 6jii:H, 6jii:K, 6jiu:A, 6jiu:D, 6jiu:G, 6jiu:J, 6jiy:D, 6jiy:G, 6jiy:J, 6jv2:A, 6jv2:C, 6jv2:E, 6jv2:G |
| 4 |
5go9:A |
3423 |
69 |
0.1583 |
0.0056 |
0.2754 |
0.58 |
5go9:B, 5go9:C, 5go9:D, 5goa:A, 5goa:B, 5goa:C, 5goa:D |
| 5 |
6jrs:A |
3488 |
69 |
0.1583 |
0.0054 |
0.2754 |
0.59 |
6jrs:D, 6jrs:G, 6jrs:J |
| 6 |
8sk0:B |
330 |
35 |
0.0917 |
0.0333 |
0.3143 |
1.2 |
8shh:A, 8shh:B, 8sk0:A |
| 7 |
1jba:A |
189 |
74 |
0.1750 |
0.1111 |
0.2838 |
1.4 |
|
| 8 |
3uq6:A |
345 |
43 |
0.1250 |
0.0435 |
0.3488 |
3.2 |
4dc3:A, 4dc3:B, 3uq6:B, 3uq9:A, 3uq9:B, 3vaq:A, 3vaq:B, 3vas:A, 3vas:B |
| 9 |
6zck:A |
271 |
47 |
0.1500 |
0.0664 |
0.3830 |
3.4 |
|
| 10 |
5fjw:A |
263 |
39 |
0.1333 |
0.0608 |
0.4103 |
4.3 |
5fjw:B, 5fjw:F, 5fjw:C, 5fjw:D, 5fjw:G, 5fjw:E, 5fjw:H, 5fjx:B, 5fjx:A, 5fjz:A, 5fjz:C, 5fjz:B, 5fjz:D, 5fk0:B |
| 11 |
4hcf:B |
96 |
30 |
0.0833 |
0.1042 |
0.3333 |
4.8 |
4hcf:A, 4hcg:A, 4hcg:B |
| 12 |
5lm1:A |
339 |
37 |
0.1000 |
0.0354 |
0.3243 |
7.2 |
|
| 13 |
4kik:B |
650 |
46 |
0.1000 |
0.0185 |
0.2609 |
9.2 |
|
| 14 |
4kik:A |
619 |
46 |
0.1000 |
0.0194 |
0.2609 |
9.6 |
|
| 15 |
8hg9:A |
392 |
84 |
0.1750 |
0.0536 |
0.2500 |
9.8 |
8hg9:B |
| 16 |
4v6x:CU |
112 |
57 |
0.1583 |
0.1696 |
0.3333 |
9.9 |
7a01:82, 8a3d:O, 5aj0:AU, 8b5l:U, 8b6c:U, 9bdl:AL22, 9bdn:AL22, 9bdp:AL22, 7bhp:LU, 8bhf:H1, 8bpo:T2, 8btk:BU, 7cpu:LU, 7cpv:LU, 4d5y:U, 4d67:U, 6d90:U, 6d9j:U, 9f1b:BU, 9f1c:BU, 9f1d:BU, 7f5s:LU, 8fkz:LF, 8fl2:LF, 8fl3:LF, 8fl4:LF, 8fl6:LF, 8fl7:LF, 8fl9:LF, 8fla:LF, 8flb:LF, 8flc:LF, 8fld:LF, 8fle:LF, 8flf:LF, 9fq0:LU, 6frk:U, 6ftg:U, 6fti:U, 6ftj:U, 8g5y:LU, 8g5z:LU, 8g60:LU, 8g61:LU, 8g6j:LU, 8glp:LU, 6gz3:AU, 6gz4:AU, 6gz5:AU, 6hcf:U3, 6hcj:U3, 6hcm:U3, 6hcq:U3, 8idt:d, 8idy:d, 8ie3:d, 8ifd:2O, 8ife:2O, 8ine:d, 8inf:d, 8ink:d, 6ip5:2O, 6ip6:2O, 6ip8:2O, 8ipd:d, 8ipx:d, 8ipy:d, 8ir1:d, 8ir3:d, 3j7o:U, 3j7p:U, 3j7q:U, 3j7r:U, 3j92:U, 3jag:U, 3jah:U, 3jai:U, 3jaj:U, 3jan:U, 8jdj:Z, 8jdk:Z, 8jdl:Z, 8jdm:Z, 8k2c:LU, 5lks:LU, 6lqm:d, 6lsr:d, 6lss:d, 7ls1:O2, 7ls2:O2, 6lu8:d, 5lzs:U, 5lzt:U, 5lzu:U, 5lzv:U, 5lzw:U, 5lzx:U, 5lzy:U, 5lzz:U, 7mdz:U, 6mtb:U, 6mtc:U, 6mtd:U, 6mte:U, 7nfx:U, 7nwg:U3, 7nwh:U, 7nwi:U, 7o7y:BU, 7o7z:BU, 7o80:BU, 7o81:BU, 7obr:U, 8ohd:LU, 8oj0:LU, 8oj5:LU, 8oj8:LU, 6ole:V, 6olf:V, 6olg:AU, 6oli:V, 6olz:AU, 6om0:V, 6om7:V, 7oya:U1, 7oyb:U1, 7oyc:U1, 7oyd:U, 8p2k:BU, 6p5i:AU, 6p5j:AU, 6p5k:AU, 6p5n:AU, 8q7z:BU, 8q87:BU, 8qfd:U, 7qgg:V, 8qoi:LU, 7qvp:LU, 7qvp:MU, 7qwq:U, 7qwr:U, 7qws:U, 6qzp:LU, 6r5q:U, 6r6g:U, 6r6p:U, 6r7q:U, 8rjb:U, 8rjc:U, 8rjd:U, 8scb:U, 6sgc:U2, 6swa:S, 5t2c:O, 6t59:U3, 7tm3:U, 7toq:AL22, 7tor:AL22, 7tut:U, 7ucj:U, 7uck:U, 4ug0:LU, 4ujc:BU, 4ujd:AU, 4uje:CU, 6w6l:V, 6xa1:LU, 7xnx:LU, 7xny:LU, 8xsx:LU, 8xsy:LU, 8xsz:LU, 6y0g:LU, 8y0w:LU, 8y0x:LU, 6y2l:LU, 6y57:LU, 6y6x:LU, 8yoo:LU, 8yop:LU, 6z6l:LU, 6z6m:LU, 6z6n:LU, 7zjw:LX, 7zjx:LX, 6zm7:LU, 6zme:LU, 6zmi:LU, 6zmo:LU, 6zvk:82 |
umich.edu