LGSMDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSRVESALNPIDLTVLAEYHKQIESNLQRIERK
NQRTW
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gov:N | 110 | 85 | 1.0000 | 0.7727 | 1.0000 | 1.74e-57 | 5lm7:N, 5lm7:F, 5ms0:N, 1qfq:B |
2 | 6n13:B | 322 | 32 | 0.1412 | 0.0373 | 0.3750 | 0.44 | 2jmo:A |
3 | 6uzi:C | 470 | 56 | 0.1412 | 0.0255 | 0.2143 | 3.2 | 6uzi:A, 6uzi:B, 6uzi:D |
4 | 4yfy:A | 241 | 41 | 0.1647 | 0.0581 | 0.3415 | 3.6 | 4yfy:B |
5 | 4zyn:B | 385 | 29 | 0.1176 | 0.0260 | 0.3448 | 5.3 | 4k7d:A, 4k7d:B, 4k7d:C, 4k95:A, 4k95:B, 4k95:C, 4k95:D, 4k95:E, 4k95:F, 4k95:G, 4k95:H, 4k95:I, 4k95:J, 4k95:K, 4k95:L, 7us1:A, 8w31:A, 4zyn:A |