LEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFV
A
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5d4s:B | 83 | 81 | 0.9877 | 0.9639 | 0.9877 | 6.31e-53 | 5d4r:A, 5d4r:B, 5d4s:A, 4egy:A, 4egy:B, 4egz:A, 4egz:B, 4h0e:A, 4h0e:B |
2 | 4wwc:A | 213 | 67 | 0.3704 | 0.1408 | 0.4478 | 1.37e-17 | |
3 | 4u0v:A | 243 | 67 | 0.3704 | 0.1235 | 0.4478 | 2.04e-17 | 4u0v:B, 4u0w:A, 4u0w:B, 4u0y:A, 4u0y:B, 4u0y:C, 4u0y:D, 4wwc:B |
4 | 7zla:B | 458 | 72 | 0.2346 | 0.0415 | 0.2639 | 0.001 | 7pq9:AAA, 7pq9:BBB, 7pq9:CCC, 7pq9:DDD, 7pq9:EEE, 7pq9:FFF, 7pq9:GGG, 7pq9:HHH, 7pq9:III, 7pq9:JJJ, 7zpa:A, 7zpa:B |
5 | 6wfq:C | 228 | 50 | 0.2099 | 0.0746 | 0.3400 | 0.002 | 6on4:A, 6on4:B, 6wfq:D, 6wg7:C, 6wg7:D, 6wg7:E, 6wg7:G, 6wg7:F, 6wg7:H |
6 | 7zn5:B | 435 | 65 | 0.2222 | 0.0414 | 0.2769 | 0.003 | 7zn5:A |
7 | 2di3:A | 231 | 62 | 0.1975 | 0.0693 | 0.2581 | 0.005 | 2di3:B |
8 | 5dv5:A | 267 | 48 | 0.2099 | 0.0637 | 0.3542 | 0.035 | 5dv5:B |
9 | 4p9u:E | 272 | 48 | 0.2099 | 0.0625 | 0.3542 | 0.042 | 4p9u:F, 4p9u:A, 4p9u:B, 4pdk:A, 4pdk:B |
10 | 7u5q:A | 217 | 61 | 0.2346 | 0.0876 | 0.3115 | 0.048 | 7u5q:B |
11 | 7dd9:A | 1129 | 53 | 0.1852 | 0.0133 | 0.2830 | 0.067 | 7dd9:C, 7dd9:E, 7dd9:G, 6lz1:A, 6lz1:B, 6lz1:C, 6lz1:D |
12 | 8gr7:A | 326 | 36 | 0.1728 | 0.0429 | 0.3889 | 0.12 | 8gr7:B |
13 | 1h9t:A | 232 | 51 | 0.2222 | 0.0776 | 0.3529 | 0.16 | 1h9g:A, 1h9t:B, 1hw2:A, 1hw2:B |
14 | 7sqc:1C | 1700 | 68 | 0.2346 | 0.0112 | 0.2794 | 0.29 | 7sqc:1D |
15 | 3tgn:B | 146 | 29 | 0.1481 | 0.0822 | 0.4138 | 1.0 | 3tgn:A |
16 | 8c00:t | 619 | 32 | 0.1481 | 0.0194 | 0.3750 | 1.4 | 8c01:t, 6rbd:k, 7wtr:CC |
17 | 7wtp:CC | 661 | 32 | 0.1481 | 0.0182 | 0.3750 | 1.4 | 6eml:t, 6wdr:k, 7wtq:CC |
18 | 8cbj:k | 670 | 32 | 0.1481 | 0.0179 | 0.3750 | 1.4 | 6fai:k, 6y7c:t |
19 | 6za0:A | 240 | 29 | 0.1481 | 0.0500 | 0.4138 | 2.6 | 6z74:A, 6z74:B, 6z74:C, 6z74:D, 6za0:B, 6za3:A, 6za3:B, 6za7:A, 6za7:B, 6za7:C, 6za7:D, 6zab:A |
20 | 3iec:B | 313 | 27 | 0.1358 | 0.0351 | 0.4074 | 2.9 | 5eak:A, 5eak:B, 3iec:A, 3iec:C, 3iec:D, 5kz8:A, 5kz8:B, 8txy:A, 8txy:B |
21 | 5kz7:A | 296 | 27 | 0.1358 | 0.0372 | 0.4074 | 3.0 | 5kz7:B |
22 | 6xzd:CP1 | 772 | 45 | 0.1975 | 0.0207 | 0.3556 | 3.3 | |
23 | 1sy7:A | 698 | 28 | 0.1358 | 0.0158 | 0.3929 | 3.4 | 1sy7:B |
24 | 7qiy:P | 75 | 43 | 0.1605 | 0.1733 | 0.3023 | 4.3 | 8auv:I, 8b2l:I1, 7qiz:ZA |
25 | 7uka:A | 368 | 59 | 0.2346 | 0.0516 | 0.3220 | 4.7 | |
26 | 2fbh:A | 137 | 45 | 0.1728 | 0.1022 | 0.3111 | 6.2 | |
27 | 3i5x:A | 509 | 26 | 0.1235 | 0.0196 | 0.3846 | 6.9 | 4db2:C, 4db2:A, 4db2:B, 4db2:D, 4db4:A, 3i5y:A, 3i61:A, 3i62:A, 3sqw:A, 3sqx:A, 4tyn:A, 4tyw:A, 4tyy:A, 4tz0:A, 4tz6:A |
28 | 8d1x:D | 469 | 58 | 0.1975 | 0.0341 | 0.2759 | 8.7 | 8d1x:A, 8d1x:B, 8d1x:C, 8d1x:E, 8d1x:F |
29 | 3mkv:A | 414 | 60 | 0.1975 | 0.0386 | 0.2667 | 9.7 | 3mkv:B, 3mkv:C, 3mkv:D, 3mkv:E, 3mkv:F, 3mkv:G, 3mkv:H |