BioLiP

>protein
LERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLT
NIDNKPALS

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7tt7:E	89	89	1.0000	1.0000	1.0000	5.17e-63
2	5wam:B	97	79	0.3146	0.2887	0.3544	1.47e-09
3	4tuf:A	346	40	0.1573	0.0405	0.3500	4.4	4tuf:B, 4tuf:C, 4tuf:D
4	2die:A	481	40	0.1685	0.0312	0.3750	5.1
5	3bht:B	262	85	0.2360	0.0802	0.2471	5.1	3bht:D, 3bhu:B, 3bhu:D, 3bhv:B, 3bhv:D, 2c5v:B, 2c5v:D, 2cch:B, 2cch:D, 2cci:B, 2cci:D, 4cfu:D, 4cfv:B, 4cfv:D, 4eoj:B, 4eol:B, 4eom:D, 4eon:B, 4eon:D, 4eoo:B, 4eop:D, 4eoq:B, 1gy3:D, 1h24:B, 1h25:B, 1h26:B, 1h27:B, 1h28:B, 1h28:D, 2iw6:B, 2iw9:B, 2iw9:D, 5lmk:B, 1oi9:B, 1oiu:B, 1oiy:B, 1okv:B, 1okv:D, 1okw:B, 1okw:D, 1ol1:B, 1ol1:D, 1ol2:B, 1ol2:D, 6p3w:B, 6p3w:D, 3qhr:D, 3qhr:B, 3qhw:B, 3qhw:D, 1urc:B, 1urc:D, 2uue:B, 2uue:D, 2v22:B, 2v22:D, 2wev:B, 2wev:D, 2wfy:B, 2wfy:D, 2whb:B, 2whb:D, 2wma:B, 2wmb:B, 2x1n:D
6	6ag0:C	483	74	0.2360	0.0435	0.2838	5.3	6ag0:A, 1hvx:A, 4uzu:A
7	8evb:B	432	41	0.1348	0.0278	0.2927	6.8
8	8etp:C	454	41	0.1348	0.0264	0.2927	6.8	8etp:A, 8etp:B, 8eu3:A, 8eu3:B, 8eu3:C, 8euc:A, 8euc:B, 8euc:C, 8ev8:A, 8ev8:B, 8ev8:C, 8ev9:A, 8ev9:B, 8ev9:C, 8eva:A, 8eva:B, 8eva:C, 8evb:A, 8evb:C, 8evc:A, 8evc:B, 8evc:C
9	4kps:A	324	52	0.1461	0.0401	0.2500	8.1	4kps:E

[Back]