LDSLLENLRAEIDALDNELSDLLDKRLEIALKIALIKQESPIYCPKREQEILKRLSQRDFKHLNGEILTGFYTEVFKISR
KFQENALKELK
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6al9:B | 91 | 91 | 1.0000 | 1.0000 | 1.0000 | 1.73e-60 | 6al9:A |
| 2 | 5j6f:A | 352 | 83 | 0.2637 | 0.0682 | 0.2892 | 0.003 | 5j6f:B |
| 3 | 1ecm:B | 95 | 85 | 0.2747 | 0.2632 | 0.2941 | 0.087 | 1ecm:A |
| 4 | 3nvt:A | 345 | 77 | 0.2308 | 0.0609 | 0.2727 | 0.10 | 3nvt:B, 3tfc:A, 3tfc:B |
| 5 | 5gmu:B | 87 | 85 | 0.2088 | 0.2184 | 0.2235 | 1.7 | 5gmu:A |
| 6 | 3ghg:B | 401 | 54 | 0.1648 | 0.0374 | 0.2778 | 2.1 | 3bvh:E, 3bvh:B, 3e1i:B, 3e1i:E, 2ffd:E, 2ffd:B, 1fzc:B, 1fzc:E, 1fze:B, 1fze:E, 1fzf:B, 1fzf:E, 1fzg:B, 1fzg:E, 3ghg:E, 3ghg:H, 3ghg:K, 3h32:B, 3h32:E, 2h43:B, 2h43:E, 2hlo:B, 2hlo:E, 2hod:B, 2hod:E, 2hod:H, 2hod:K, 2hpc:B, 2hpc:E, 2hpc:H, 2hpc:K, 3hus:B, 3hus:E, 1lt9:B, 1lt9:E, 1ltj:B, 1ltj:E, 1n86:B, 1n86:E, 2oyh:B, 2oyh:E, 2oyi:B, 2oyi:E, 2q9i:B, 2q9i:E, 1re3:B, 1re3:E, 1re4:B, 1re4:E, 1rf0:B, 1rf0:E, 1rf1:B, 1rf1:E, 2z4e:B, 2z4e:E |
| 7 | 7sl6:A | 819 | 21 | 0.0989 | 0.0110 | 0.4286 | 5.0 | 7mqs:F, 7mqs:E, 7sl1:A, 7sl1:B, 7sl2:A, 7sl2:B, 7sl6:B, 7sl7:A, 7sl7:B |
| 8 | 5wbj:A | 1058 | 65 | 0.1978 | 0.0170 | 0.2769 | 5.2 | 5wbk:A, 5wbl:A |
| 9 | 3qcp:A | 410 | 52 | 0.1758 | 0.0390 | 0.3077 | 5.9 | 3qd9:A, 3qd9:B, 3qd9:C, 3qd9:D |
| 10 | 8jus:A | 335 | 44 | 0.1978 | 0.0537 | 0.4091 | 8.9 | 8jus:B |
zhanggroup.org