LDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDVMTPE
ALKVFIDEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSET
The query sequence (length=154) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3lor:B | 154 | 154 | 1.0000 | 1.0000 | 1.0000 | 6.02e-112 | |
2 | 2yp6:A | 143 | 125 | 0.1818 | 0.1958 | 0.2240 | 0.043 | 2yp6:B, 2yp6:C, 2yp6:D |
3 | 5oas:A | 728 | 89 | 0.1494 | 0.0316 | 0.2584 | 0.23 | 5vfb:A, 5vfb:B |
4 | 4wbr:D | 157 | 128 | 0.1818 | 0.1783 | 0.2188 | 0.96 | |
5 | 4qen:A | 472 | 86 | 0.1429 | 0.0466 | 0.2558 | 1.5 | 4qeo:A, 4qep:A |
6 | 1h31:B | 138 | 101 | 0.1818 | 0.2029 | 0.2772 | 1.7 | 1h31:D, 1h31:F, 1h31:H, 1h32:B, 1h33:B, 2oz1:B, 2oz1:D, 2oz1:F, 2oz1:H |
7 | 1ep3:A | 311 | 82 | 0.1299 | 0.0643 | 0.2439 | 1.9 | 1ep1:A, 1ep2:A, 5ksw:A, 5ksw:C, 5ue9:A, 5ue9:C |
8 | 2die:A | 481 | 39 | 0.0909 | 0.0291 | 0.3590 | 2.6 | |
9 | 2rem:C | 191 | 27 | 0.0714 | 0.0576 | 0.4074 | 3.4 | |
10 | 6slo:A | 214 | 53 | 0.0974 | 0.0701 | 0.2830 | 9.0 | 6lur:B, 6lur:C, 6lur:D, 6lur:A, 6lur:E, 6slo:C, 6slo:D |
11 | 6n63:A | 141 | 41 | 0.0909 | 0.0993 | 0.3415 | 9.7 |