KVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDV
The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gad:i | 450 | 43 | 0.9767 | 0.0933 | 0.9767 | 2.17e-22 | 4c7o:A, 4c7o:C, 5gag:i, 5gah:i, 5nco:i, 7o9g:A, 7o9i:A, 2xkv:C, 2xxa:A, 2xxa:C |
2 | 5gaf:i | 398 | 43 | 0.9767 | 0.1055 | 0.9767 | 8.82e-22 | 1dul:A, 1hq1:A, 3lqx:A, 2pxb:A, 2pxd:A, 2pxe:A, 2pxf:A, 2pxk:A, 2pxl:A, 2pxp:A, 2pxq:A, 2pxt:A, 2pxu:A, 2pxv:A |
3 | 2j28:9 | 430 | 43 | 0.9767 | 0.0977 | 0.9767 | 1.07e-21 | 5aka:5 |
4 | 7o5b:g | 403 | 43 | 0.5581 | 0.0596 | 0.5581 | 9.38e-09 | 7o9f:A, 7o9f:C, 7o9f:B, 4ue4:C |
5 | 3ndb:B | 420 | 39 | 0.5116 | 0.0524 | 0.5641 | 8.64e-07 | 2v3c:C, 2v3c:D, 4xco:D |
6 | 4xco:C | 157 | 39 | 0.5116 | 0.1401 | 0.5641 | 9.30e-07 | |
7 | 7epk:A | 426 | 39 | 0.5349 | 0.0540 | 0.5897 | 1.01e-06 | |
8 | 3dm5:A | 416 | 41 | 0.4651 | 0.0481 | 0.4878 | 1.37e-05 | 3dm5:B |
9 | 1qzw:A | 432 | 33 | 0.4651 | 0.0463 | 0.6061 | 1.62e-05 | 3kl4:A, 5l3s:A, 5l3s:C, 5l3s:E, 5l3s:G, 5l3v:A, 5l3v:B, 1qzw:C, 1qzw:E, 1qzw:G, 3zn8:M |
10 | 7uea:U | 364 | 32 | 0.2558 | 0.0302 | 0.3438 | 0.60 | 3bsd:A, 3eni:A, 3eni:C, 8gwa:1, 8gwa:2, 8gwa:3, 8gwa:4, 8gwa:5, 8gwa:6, 5h8z:A, 5h8z:C, 6m32:E, 6m32:F, 6m32:G, 7uea:V, 7uea:W, 7ueb:U, 7ueb:V, 7ueb:W, 7ueb:X, 7ueb:Y, 7ueb:Z, 7z6q:E, 7z6q:F, 7z6q:G, 7z6q:H, 7z6q:I, 7z6q:J |
11 | 3qo8:A | 441 | 22 | 0.2326 | 0.0227 | 0.4545 | 1.4 | 3qo7:A |
12 | 3o0n:A | 607 | 32 | 0.2558 | 0.0181 | 0.3438 | 4.5 | 1xjm:B |
13 | 6mez:B | 359 | 33 | 0.2093 | 0.0251 | 0.2727 | 4.9 | 4bcl:A, 3eoj:A, 6mez:A, 3vdi:A |
14 | 1xje:A | 627 | 32 | 0.2558 | 0.0175 | 0.3438 | 5.5 | 3o0n:B, 3o0o:A, 3o0o:B, 3o0q:A, 3o0q:B, 1xje:B, 1xjf:A, 1xjf:B, 1xjg:A, 1xjg:B, 1xjj:A, 1xjj:B, 1xjk:A, 1xjk:B, 1xjm:A, 1xjn:A, 1xjn:B, 1xjn:C, 1xjn:D |
15 | 7b6b:A | 346 | 20 | 0.1860 | 0.0231 | 0.4000 | 7.4 | 7b6b:B |
16 | 8wm7:D | 257 | 41 | 0.2326 | 0.0389 | 0.2439 | 7.5 | 8w9m:D |
17 | 5gja:A | 299 | 23 | 0.2558 | 0.0368 | 0.4783 | 9.3 | 5gj9:A, 5gj9:B, 5gja:B, 5gja:C, 5gja:D, 5gja:E, 5gja:F, 5gja:G, 5gja:H |