KVLTIKSCNIHSGIGIRPHAQIELEYQGKIHKEISEGDGGYDAFMNALTKITNRLGISIPKLIDYEVRIPPGGKTDALVE
The query sequence (length=115) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3f6h:B |
125 |
121 |
1.0000 |
0.9200 |
0.9504 |
1.04e-80 |
3f6g:B, 3f6g:A, 3f6h:A |
2 |
6qud:A |
837 |
70 |
0.2000 |
0.0275 |
0.3286 |
0.45 |
|
3 |
7wf3:C |
328 |
60 |
0.1826 |
0.0640 |
0.3500 |
0.53 |
2a79:A, 3eau:A, 3eb3:A, 3eb4:A, 6ebk:A, 6ebk:C, 6ebk:E, 6ebk:G, 6ebl:A, 6ebl:C, 6ebl:E, 6ebl:G, 7ej1:A, 7ej1:C, 7ej1:E, 7ej1:G, 7ej2:A, 7ej2:C, 7ej2:E, 7ej2:G, 1exb:A, 4jta:A, 4jta:P, 4jtc:A, 4jtc:G, 4jtd:A, 4jtd:G, 3lnm:A, 3lnm:C, 3lut:A, 1qrq:A, 1qrq:B, 1qrq:C, 1qrq:D, 2r9r:A, 2r9r:G, 7sit:A, 7sit:C, 7siz:A, 7siz:C, 7wf3:G, 7wf3:I, 7wf3:M, 7wf4:G, 7wf4:I, 7wf4:M, 7wf4:o, 5wie:A, 5wie:G, 1zsx:A |
4 |
6ii7:A |
355 |
71 |
0.1652 |
0.0535 |
0.2676 |
1.1 |
|
5 |
8ity:V |
361 |
74 |
0.1652 |
0.0526 |
0.2568 |
1.3 |
8iue:V, 8iuh:V, 5n9g:A, 5n9g:F, 4roc:A, 4rod:A, 4roe:A |
6 |
1d3y:B |
290 |
74 |
0.1739 |
0.0690 |
0.2703 |
1.6 |
1d3y:A |
7 |
7nit:D |
1253 |
70 |
0.1913 |
0.0176 |
0.3143 |
1.8 |
5dmy:A, 5dmy:B, 5dmy:C, 7nit:A, 7nit:B, 7nit:C, 7nit:E, 7nit:F, 6qub:A, 6qub:B, 6quc:A, 6quc:B |
8 |
4fm4:A |
206 |
64 |
0.1304 |
0.0728 |
0.2344 |
3.3 |
4fm4:C, 4fm4:E, 4fm4:G, 4fm4:I, 4fm4:K, 4fm4:M, 4fm4:O, 4zgd:A, 4zgd:C, 4zgd:E, 4zgd:G, 4zgd:I, 4zgd:K, 4zgd:M, 4zgd:O, 4zge:A, 4zge:C, 4zge:E, 4zge:G, 4zge:I, 4zge:K, 4zge:M, 4zge:O, 4zgj:A, 4zgj:C, 4zgj:E, 4zgj:G, 4zgj:I, 4zgj:K, 4zgj:M, 4zgj:O |
9 |
3h0d:A |
155 |
79 |
0.1913 |
0.1419 |
0.2785 |
6.1 |
3h0d:B |
10 |
7myl:B |
158 |
42 |
0.1304 |
0.0949 |
0.3571 |
7.6 |
5ecc:A, 5ecc:B, 5ecx:A, 5ecx:B, 7myl:A, 7myl:C, 7myl:D, 7myl:E, 7myl:F, 7reg:A, 7reg:B, 7rgj:A, 7rgj:B |