KVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAPRYRVDVVGTNPKEASEALNQIISNLIKIGK
EENVDISVV
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5jb3:9 | 254 | 89 | 1.0000 | 0.3504 | 1.0000 | 1.91e-56 | 5jbh:9, 3qsy:B, 3v11:B |
2 | 2pbf:A | 218 | 32 | 0.1348 | 0.0550 | 0.3750 | 0.67 | 2pbf:B |
3 | 5vp5:A | 411 | 38 | 0.1685 | 0.0365 | 0.3947 | 2.9 | |
4 | 6gnc:A | 287 | 24 | 0.1011 | 0.0314 | 0.3750 | 4.0 | |
5 | 6kc0:A | 674 | 38 | 0.1236 | 0.0163 | 0.2895 | 4.8 | 6kbd:A |
6 | 6muu:A | 780 | 38 | 0.1236 | 0.0141 | 0.2895 | 5.2 | 6iqw:A, 6mur:A, 6mus:A, 6mut:A, 6o7e:A, 6o7h:A |
7 | 6o7i:A | 741 | 38 | 0.1236 | 0.0148 | 0.2895 | 5.3 | |
8 | 2jgq:A | 231 | 46 | 0.1685 | 0.0649 | 0.3261 | 5.7 | 2jgq:B |
9 | 6n63:A | 141 | 58 | 0.1685 | 0.1064 | 0.2586 | 5.8 | |
10 | 6o75:A | 710 | 38 | 0.1236 | 0.0155 | 0.2895 | 5.9 | 6o74:A, 6o78:A, 6o79:A, 6o7b:A, 6o7d:A |
11 | 7r81:f1 | 104 | 46 | 0.1461 | 0.1250 | 0.2826 | 6.6 | |
12 | 7aoe:A | 1401 | 29 | 0.1236 | 0.0079 | 0.3793 | 6.8 | 7aoc:A, 7aod:A, 7aod:M |
13 | 6khn:A | 490 | 64 | 0.1573 | 0.0286 | 0.2188 | 6.9 | 6khn:B, 6kho:A, 6kho:B, 6khp:A, 6khp:B |
14 | 2yye:B | 343 | 55 | 0.1685 | 0.0437 | 0.2727 | 9.4 | 2yye:A, 2zau:A, 2zau:C |
15 | 1i1n:A | 224 | 30 | 0.1011 | 0.0402 | 0.3000 | 9.7 | 1kr5:A |