KTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDD
SIEDLGE
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6vpq:A | 87 | 87 | 1.0000 | 1.0000 | 1.0000 | 1.52e-58 | 6vpq:B, 6vpq:C, 6vpq:E, 6vpq:F, 5vyc:l1, 5vyc:l2, 5vyc:l3, 5vyc:l4, 5vyc:l5, 5vyc:l6 |
2 | 7ase:V | 97 | 67 | 0.2299 | 0.2062 | 0.2985 | 0.033 | |
3 | 4pu6:B | 131 | 28 | 0.1379 | 0.0916 | 0.4286 | 0.43 | |
4 | 2qmu:C | 132 | 41 | 0.1034 | 0.0682 | 0.2195 | 0.58 | 5jb3:8 |
5 | 5jb3:1 | 83 | 58 | 0.2299 | 0.2410 | 0.3448 | 0.73 | 5jbh:1 |
6 | 4bts:AF | 89 | 64 | 0.2069 | 0.2022 | 0.2812 | 0.93 | 4bts:BF, 4bts:CF, 4bts:DF, 4v5o:AF, 4v5o:BF |
7 | 5zcy:A | 83 | 62 | 0.2299 | 0.2410 | 0.3226 | 1.2 | |
8 | 6f5u:B | 131 | 59 | 0.1839 | 0.1221 | 0.2712 | 2.5 | 6f6i:B, 6f6n:B, 6f6s:B, 8f87:B, 6g95:B, 6g9b:B, 6hro:B, 6hs4:B, 5jq7:B, 5jqb:B, 7lyd:B, 7lyy:B, 7m2d:B, 6nae:B, 7ssq:B, 7ssr:B |
9 | 5y6q:C | 748 | 38 | 0.1724 | 0.0201 | 0.3947 | 3.4 | |
10 | 5olk:A | 395 | 28 | 0.1379 | 0.0304 | 0.4286 | 6.1 | 5olk:B, 5olk:C, 5olk:D, 6sf5:A, 6sf5:B |
11 | 6kbw:A | 446 | 37 | 0.1264 | 0.0247 | 0.2973 | 8.1 | 6kbw:B |
12 | 8thm:B | 462 | 55 | 0.2184 | 0.0411 | 0.3455 | 8.4 | 8thm:A, 8thm:C, 8thm:D, 8thm:F, 8thm:E |
13 | 3lya:A | 318 | 70 | 0.1034 | 0.0283 | 0.1286 | 8.5 | |
14 | 6jyg:D | 307 | 24 | 0.1264 | 0.0358 | 0.4583 | 9.6 | 6jyg:A, 6jyg:B, 6jyg:C, 6jyg:E, 6jyg:F |