KTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKASEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQ
IIHWYIAEQIKYWRQTR
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2h9d:D | 100 | 97 | 1.0000 | 0.9700 | 1.0000 | 8.76e-68 | 2h9c:A, 2h9c:B, 2h9d:B, 2h9d:C, 3hgw:D, 3hgx:A, 3rem:A, 3rem:B, 3ret:B |
2 | 2h9d:A | 84 | 93 | 0.8557 | 0.9881 | 0.8925 | 2.10e-54 | |
3 | 7aor:z | 1071 | 42 | 0.1856 | 0.0168 | 0.4286 | 0.22 | |
4 | 6hiv:Cv | 1059 | 43 | 0.1753 | 0.0161 | 0.3953 | 0.59 | 6hiw:Cv, 6hiy:Cv, 7pub:Cv |
5 | 4ll2:B | 224 | 44 | 0.1443 | 0.0625 | 0.3182 | 0.62 | 4oei:A, 4oei:B, 3s18:A, 3s18:B, 3v6n:A, 3v6n:B, 4yeh:A, 4yeh:B |
6 | 7rj1:A | 265 | 46 | 0.1546 | 0.0566 | 0.3261 | 0.73 | 7rj1:B, 7rj1:C, 7rj1:D |
7 | 5en7:A | 177 | 31 | 0.1031 | 0.0565 | 0.3226 | 2.8 | 5en6:A, 5en7:C, 5en7:E, 5en7:G |
8 | 6q8j:A | 188 | 31 | 0.1031 | 0.0532 | 0.3226 | 3.8 | |
9 | 4iqj:A | 1164 | 28 | 0.1340 | 0.0112 | 0.4643 | 5.1 | |
10 | 4iqj:D | 1185 | 28 | 0.1340 | 0.0110 | 0.4643 | 5.1 | 3e0d:A, 3e0d:B, 2hpi:A, 2hpm:A, 4iqj:B, 4iqj:C |
11 | 7stm:A | 801 | 45 | 0.1237 | 0.0150 | 0.2667 | 7.3 | 7stm:B, 7stn:A, 7stn:B, 7sto:B, 7sto:A |
12 | 8k3u:A | 597 | 45 | 0.1340 | 0.0218 | 0.2889 | 7.6 | 8k3u:B |
13 | 8k3p:A | 660 | 45 | 0.1340 | 0.0197 | 0.2889 | 7.7 | 8k3p:B, 8k3t:A, 8k3t:B |
14 | 8k3w:B | 694 | 45 | 0.1340 | 0.0187 | 0.2889 | 7.7 | 8k3w:A, 8k3x:A, 8k3x:B |
15 | 7xs6:B | 729 | 45 | 0.1340 | 0.0178 | 0.2889 | 7.7 | 8k3v:A, 8k3v:B, 7xs6:A, 7xs7:B, 7xs7:A |
16 | 5msr:B | 520 | 50 | 0.1546 | 0.0288 | 0.3000 | 9.6 | 5msp:A, 5msr:A, 5msr:C, 5msr:D, 5msv:A, 5msv:B, 5msv:C, 5msv:D |
17 | 3aib:G | 844 | 33 | 0.1237 | 0.0142 | 0.3636 | 9.7 | 3aib:A, 3aib:B, 3aib:C, 3aib:D, 3aib:E, 3aib:F, 3aib:H, 3aic:A, 3aic:B, 3aic:C, 3aic:D, 3aic:E, 3aic:F, 3aic:G, 3aic:H, 3aie:A, 3aie:B, 3aie:C, 3aie:D, 3aie:E, 3aie:F, 3aie:G, 3aie:H, 8fg8:A, 8fg8:B, 8fj9:A, 8fj9:B, 8fjc:A, 8fjc:B, 8fk4:A, 8fk4:B, 8fk4:C, 8fk4:D, 8fk4:E, 8fk4:F, 8fk4:G, 8fk4:H, 8uf5:A, 8uf5:B |