BioLiP

>protein
KTLEELATERGMRMTEQRRVIARILEDSEDHPDVEELYRRSVKVDAKISISTVYRTVKLFEDAGIIARHDFRDGRSRYET
VPEEHHDHLIDLKTGTVIEFRSPEIEALQERIAREHGFRLVDHRLELYGVPLK

The query sequence (length=133) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5fd6:A	135	133	1.0000	0.9852	1.0000	9.56e-93	5fd6:B, 5fd6:C, 5fd6:D
2	4rb3:C	136	130	0.6466	0.6324	0.6615	1.38e-60	4raz:A, 4raz:B, 4rb1:A, 4rb1:B, 4rb2:C, 4rb2:D, 4rb3:D
3	8j6w:A	145	120	0.3985	0.3655	0.4417	1.91e-31
4	2w57:A	131	122	0.3684	0.3740	0.4016	1.53e-27	2w57:B
5	6d57:B	151	124	0.3609	0.3179	0.3871	4.05e-25	6d57:A, 4ets:A, 4ets:B
6	6h1c:B	134	119	0.3459	0.3433	0.3866	2.94e-24	6h1c:A, 1mzb:A
7	5nhk:B	132	121	0.3233	0.3258	0.3554	1.54e-21	5nbc:A, 5nbc:B, 5nbc:C, 5nbc:D, 5nhk:A, 5nhk:C, 5nhk:D
8	2fe3:B	143	126	0.2932	0.2727	0.3095	1.90e-20	3f8n:A, 3f8n:B, 2fe3:A, 2rgv:A, 2rgv:B
9	2o03:A	129	125	0.3083	0.3178	0.3280	6.12e-19
10	2xig:C	150	120	0.2857	0.2533	0.3167	1.76e-18	2xig:A, 2xig:B, 2xig:D
11	7vo0:G	131	118	0.2782	0.2824	0.3136	2.05e-14	3mwm:A, 3mwm:B, 7vo0:H, 7vo0:K, 7vo0:L, 7vo0:N, 7vo0:M, 7vo9:G, 7vo9:H, 7vo9:M, 7vo9:N, 7vpd:M, 7vpd:N, 7vpz:M, 7vpz:N, 7x74:G, 7x74:H, 7x74:M, 7x74:N, 7x75:G, 7x75:H, 7x75:K, 7x75:L, 7x75:M, 7x75:N, 7x76:G, 7x76:H, 7x76:M, 7x76:N
12	6dk4:A	135	114	0.2406	0.2370	0.2807	6.80e-11	6dk4:B
13	4lmy:B	157	122	0.1880	0.1592	0.2049	3.39e-07	4i7h:A, 4i7h:B, 4lmy:A
14	5nl9:A	146	107	0.2105	0.1918	0.2617	3.89e-06	5nl9:B
15	3eyy:A	133	110	0.2331	0.2331	0.2818	4.60e-05	3eyy:B
16	7ne9:AAA	120	116	0.1955	0.2167	0.2241	0.009	7ne9:BBB, 7ne9:CCC, 7ne9:DDD
17	7dh7:C	150	142	0.2406	0.2133	0.2254	0.12	7dh7:A, 7dh7:B, 7dh7:D, 7dh8:A
18	3mvd:L	394	73	0.1579	0.0533	0.2877	0.65	3mvd:K
19	6tlk:A	289	29	0.0827	0.0381	0.3793	1.2	1lua:A, 1lua:B, 1lua:C, 6tge:A, 6tge:C, 6tge:B, 6tge:D, 6tge:F, 6tge:E, 6tge:G, 6tge:I, 6tge:H, 6tge:J, 6tge:L, 6tge:K, 6tge:M, 6tge:O, 6tge:N, 6tge:P, 6tge:R, 6tge:Q, 6tge:S, 6tge:U, 6tge:T, 6tge:V, 6tge:X, 6tge:W, 6tlk:B, 6tlk:C, 6tlk:D, 6tlk:E, 6tlk:F, 6tm3:A
20	6s6t:E	472	55	0.1504	0.0424	0.3636	1.3	6s6s:G, 6s6s:E, 6s6s:F, 6s6s:H, 6s6t:F, 6s6t:G, 6s6u:G, 6s6u:H, 6s6u:I, 6s6u:J, 6s6x:G, 6s6x:H, 6s6x:I, 6s6x:J, 6s6x:K, 6s6x:L, 2vdc:G, 2vdc:H, 2vdc:I, 2vdc:J, 2vdc:K, 2vdc:L
21	8f9x:A	230	21	0.0827	0.0478	0.5238	1.3	8f9x:B, 8f9x:C, 8f9x:D, 8f9x:E, 8f9x:F, 8f9x:G, 8f9x:H, 8f9x:I, 8f9x:J
22	4gp2:A	342	87	0.1805	0.0702	0.2759	1.7	4gp1:A, 4gp2:B
23	6r38:A	331	107	0.1579	0.0634	0.1963	1.8	5qt4:A, 5qt5:A, 5qt6:A, 5qt7:A, 5qt8:A, 5qt9:A, 5qta:A, 5qte:A, 5qtf:A, 5qtg:A, 5qth:A, 5qti:A, 5qtj:A, 5qtk:A, 6r37:A, 6r39:A, 6sii:A
24	7b0h:F	762	107	0.2256	0.0394	0.2804	2.9	7b07:A, 7b08:A, 7b0f:A, 7b0g:A, 7b0h:E, 1qqc:A, 5vu8:A, 2vwj:A, 2xhb:A
25	6tgh:A	410	39	0.1203	0.0390	0.4103	3.1	6tgh:C, 6tgh:B, 6tgh:D, 6ti1:A, 6ti1:C, 6ti3:A, 6ti3:C, 6ti3:B, 6ti3:D, 6ti4:A, 6ti4:C, 4wxf:A, 4wxf:C, 4wxg:A, 4wxg:C, 6yrw:A, 6yrw:C, 6yrw:B, 6yrw:D
26	4egu:A	118	66	0.1429	0.1610	0.2879	3.5	4egu:B
27	6ep2:K	204	38	0.0902	0.0588	0.3158	4.8	6ep0:A, 6ep0:B, 6ep2:A, 6ep2:B, 6ep2:C, 6ep2:D, 6ep2:E, 6ep2:F, 6ep2:G, 6ep2:H, 6ep2:I, 6ep2:J, 6ep2:L, 6ep5:A, 6ep5:B, 6ep5:C, 6ep5:D, 6ep5:E, 6ep5:F
28	7nkg:D	565	41	0.1128	0.0265	0.3659	5.3	7nkg:A, 7nkg:G, 7nkg:J
29	3owa:C	587	34	0.0902	0.0204	0.3529	6.9	3owa:A, 3owa:B, 3owa:D
30	7qep:N5	93	45	0.1053	0.1505	0.3111	8.9
31	4osp:A	252	49	0.1278	0.0675	0.3469	9.3

[Back]