KSFEVVFNDPEKVYGSGERVAGRVIVEVSEVTRVKAVRILASGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDEMVIMRP
GNKYEYKFGFELPQGPLGTSFKGKYGSVDYWVKAFLDRPSQPTQETKKNFEVVDLV
The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4gej:E | 142 | 142 | 1.0000 | 0.9577 | 0.9577 | 1.62e-95 | 4gej:A, 4gej:F, 4gej:C, 4gej:J, 4gej:B, 4gej:D, 4gej:H, 4gej:I |
2 | 4r7x:A | 150 | 140 | 0.4265 | 0.3867 | 0.4143 | 4.80e-28 | 4r7x:B |
3 | 7y1u:A | 723 | 62 | 0.1250 | 0.0235 | 0.2742 | 0.72 | |
4 | 9c4o:A | 661 | 66 | 0.1397 | 0.0287 | 0.2879 | 3.7 | 6v81:A |
5 | 4gua:A | 662 | 49 | 0.1103 | 0.0227 | 0.3061 | 4.1 | 4gua:B, 4gua:C |
6 | 2ytt:A | 46 | 27 | 0.0662 | 0.1957 | 0.3333 | 4.6 | |
7 | 8a5q:U | 606 | 60 | 0.1176 | 0.0264 | 0.2667 | 5.6 | 8a5d:U, 8a5p:U |
8 | 5cyo:A | 272 | 39 | 0.1029 | 0.0515 | 0.3590 | 9.0 | 5cyo:B, 4yqf:B, 4yqf:A |