KRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLEWGVVDDDMARLARQVAAIL
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1zs4:A | 82 | 73 | 1.0000 | 0.8902 | 1.0000 | 1.20e-47 | 8igr:A, 8igr:C, 8igr:B, 8igr:D, 1zs4:C, 1zs4:B, 1zs4:D |
2 | 2eqd:A | 510 | 25 | 0.1233 | 0.0176 | 0.3600 | 5.8 | 2e0p:A, 2e4t:A, 2eex:A, 2ej1:A, 2eo7:A |
3 | 8gqp:A | 62 | 18 | 0.1096 | 0.1290 | 0.4444 | 7.8 | 8gqp:C, 7yh8:A, 7yh8:C |
4 | 3lf0:A | 99 | 46 | 0.2055 | 0.1515 | 0.3261 | 9.1 |