Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
KREFERHSGSDRSSVRSEEKRSGSGSRNWGSVRDHM

The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7oya:i2 36 36 1.0000 1.0000 1.0000 8.83e-19
2 7ls1:A 61 36 0.6667 0.3934 0.6667 2.70e-12 7ls2:A, 6mte:w, 7oyd:w, 8q87:S, 8xsx:CD, 8y0w:S, 8y0x:S, 6z6m:CD
3 7oyc:i2 51 34 0.6389 0.4510 0.6765 8.97e-12
4 7w0j:E 382 30 0.3056 0.0288 0.3667 5.3 8i4p:A, 8i4r:A, 7w0j:B, 7w0j:C, 7w0j:H
5 8sr8:A 1353 17 0.2222 0.0059 0.4706 6.1 8sr8:B, 8sr8:C, 8sr8:D, 8sr9:A, 8sr9:B, 8sr9:C, 8sr9:D, 8sra:A, 8sra:B, 8sra:C, 8sra:D, 8srb:A, 8srb:B, 8srb:C, 8srb:D
6 8sre:A 1377 17 0.2222 0.0058 0.4706 6.1 8sr7:A, 8sr7:B, 8sr7:C, 8sr7:D, 8src:A, 8src:B, 8src:C, 8src:D, 8srd:A, 8srd:B, 8srd:C, 8srd:D, 8sre:B, 8sre:D, 8sre:C, 8srf:A, 8srf:B, 8srf:C, 8srf:D, 8srg:A, 8srg:B, 8srg:C, 8srg:D, 8srh:A, 8srh:B, 8srh:C, 8srh:D, 8sri:A, 8sri:B, 8sri:C, 8sri:D, 8srj:A, 8srj:B, 8srj:D, 8srj:C, 8srk:A, 8srk:B, 8srk:C, 8srk:D

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417