KQTDPKAKANSIINAIPGNNILTKTGVLGTSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMK
KVSDVLNASRNKHVEAVDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQL
EQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSK
The query sequence (length=200) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6b8h:b | 200 | 200 | 1.0000 | 1.0000 | 1.0000 | 6.99e-145 | 6b8h:q |
2 | 5lqy:V | 154 | 154 | 0.4700 | 0.6104 | 0.6104 | 6.30e-59 | |
3 | 6zpo:b | 209 | 160 | 0.2100 | 0.2010 | 0.2625 | 1.15e-07 | 2wss:T, 6z1u:b, 6zbb:b, 6zmr:b, 6zqm:b, 6zqn:b |
4 | 6fue:A | 38 | 35 | 0.0850 | 0.4474 | 0.4857 | 5.5 | 6fue:E, 6fue:F |
5 | 3amg:A | 311 | 80 | 0.1100 | 0.0707 | 0.2750 | 7.9 | 3aof:B, 3aof:A, 3azr:A, 3azr:B, 3azs:A, 3azs:B, 3azt:A, 3azt:D, 3mmw:A, 3mmw:B, 3mmw:C, 3mmw:D |
6 | 3amg:B | 291 | 80 | 0.1100 | 0.0756 | 0.2750 | 8.2 |