KPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNH
The query sequence (length=122) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
2uwn:A |
187 |
122 |
1.0000 |
0.6524 |
1.0000 |
6.47e-92 |
2v8e:A, 7zjm:B |
2 |
7nyc:C |
809 |
31 |
0.0984 |
0.0148 |
0.3871 |
0.52 |
7nyd:C |
3 |
1o5i:B |
234 |
102 |
0.1885 |
0.0983 |
0.2255 |
0.56 |
|
4 |
7ufg:B |
1182 |
50 |
0.1311 |
0.0135 |
0.3200 |
1.2 |
8d8o:B |
5 |
8bbt:A |
230 |
45 |
0.1148 |
0.0609 |
0.3111 |
1.8 |
8bc5:A, 8bck:A |
6 |
5hyp:A |
125 |
40 |
0.1066 |
0.1040 |
0.3250 |
5.3 |
5hyt:B, 5hyt:D, 5hyt:F, 5hyt:H |
7 |
6crd:B |
438 |
56 |
0.1311 |
0.0365 |
0.2857 |
5.6 |
1a14:N, 2b8h:D, 2b8h:A, 2b8h:B, 2b8h:C, 1bji:A, 2c4a:A, 2c4l:A, 6crd:E, 6crd:D, 6crd:G, 6crd:H, 6crd:C, 6crd:F, 6crd:A, 6d3b:A, 4dgr:A, 1f8b:A, 1f8c:A, 1f8d:A, 1f8e:A, 6hcx:A, 6heb:A, 6hfc:A, 6hg0:A, 1iny:A, 5jr5:D, 5jr5:B, 5jyy:A, 5l14:A, 5l15:A, 5l17:A, 5l18:A, 1l7f:A, 1l7g:A, 1l7h:A, 6lxj:B, 6lxj:C, 6lxj:D, 6lxj:A, 6mcx:A, 1mwe:A, 4mwj:A, 4mwl:A, 4mwq:A, 4mwr:A, 4mwu:A, 4mwv:A, 4mww:A, 4mwx:A, 4mwy:A, 4mx0:A, 1nca:N, 1ncb:N, 1ncc:N, 1ncd:N, 1nma:N, 1nmb:N, 1nmc:N, 1nmc:A, 1nna:A, 1nnb:A, 1nnc:A, 3nn9:A, 4nn9:A, 5nn9:A, 6nn9:A, 7nn9:A, 6pzd:A, 6pze:A, 6pzf:B, 6pzf:A, 6pzw:D, 6pzw:C, 6pzw:B, 6pzw:A, 6pzy:B, 6pzy:E, 6pzy:F, 6pzy:A, 6q1z:A, 6q1z:B, 2qwa:A, 2qwb:A, 2qwc:A, 2qwd:A, 2qwe:A, 2qwf:A, 2qwg:A, 2qwh:A, 2qwi:A, 2qwj:A, 2qwk:A, 7r6h:C, 7r6h:D, 6u02:J, 6u02:A, 6u02:B, 6u02:E, 5vh0:A, 5vh0:B, 5vh0:C, 5vh0:D, 3w09:A, 5w26:A, 5w2u:A, 5w2w:A, 5w2y:A, 4weg:A, 1xoe:A, 1xog:A, 1ybk:C |
8 |
4uop:B |
409 |
52 |
0.1393 |
0.0416 |
0.3269 |
6.7 |
4uop:A |
9 |
3t6v:A |
495 |
32 |
0.1066 |
0.0263 |
0.4062 |
7.4 |
3t6v:B, 3t6v:C, 3t6w:A, 3t6w:B, 3t6w:C, 3t6x:A, 3t6x:B, 3t6x:C, 3t6z:A, 3t6z:B, 3t6z:C, 3t71:A, 3t71:B, 3t71:C |
10 |
6wzg:R |
379 |
29 |
0.1066 |
0.0343 |
0.4483 |
8.6 |
7d3s:R, 6wi9:R |
11 |
6ncx:B |
559 |
45 |
0.1230 |
0.0268 |
0.3333 |
9.7 |
6ncx:D, 6ncx:A, 6ncx:C |