KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFV
PETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYC
ESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVVDELLA
LYKP
The query sequence (length=244) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4rtl:A | 254 | 253 | 0.9959 | 0.9567 | 0.9605 | 2.55e-180 | 2g1p:A, 2g1p:B, 4gbe:D, 4gbe:E, 4gbe:F, 4gol:D, 4gol:E, 4gol:F, 4gom:D, 4gom:E, 4gom:F, 4gon:D, 4gon:E, 4gon:F, 4goo:D, 4goo:E, 4goo:F, 2ore:D, 2ore:E, 2ore:F, 4rtj:A, 4rtk:A, 4rtm:A, 4rtn:A, 4rto:A, 4rtp:A, 4rtq:A, 4rtr:A, 4rts:A |
2 | 2dpm:A | 258 | 245 | 0.2992 | 0.2829 | 0.2980 | 6.12e-26 | |
3 | 1yf3:A | 259 | 233 | 0.2582 | 0.2432 | 0.2704 | 3.79e-18 | 1q0s:A, 1q0t:A, 1q0t:B, 1yf3:B, 1yfj:A, 1yfj:B, 1yfj:C, 1yfj:D, 1yfj:E, 1yfj:F, 1yfl:A, 1yfl:B, 1yfl:D, 1yfl:E |
4 | 7m6b:A | 244 | 206 | 0.2418 | 0.2418 | 0.2864 | 3.01e-04 | 7m6b:B |
5 | 5o1l:A | 375 | 96 | 0.1148 | 0.0747 | 0.2917 | 0.42 | 5o1l:B, 5o1m:A, 5o1m:B |
6 | 5f15:A | 541 | 89 | 0.0902 | 0.0407 | 0.2472 | 4.0 | 5ezm:A |
7 | 3if2:A | 437 | 42 | 0.0697 | 0.0389 | 0.4048 | 5.3 | 3if2:B |