BioLiP

>protein
KLTLWTTLDPSPNCRIDVDKDSKLTLVLTKCGSQILANVSLLVVKGRFQNLNYKTNPNLPKTFTIKLLFDENGILKDSSN
LDKNYWNYRNGNSILAEQYKNAVGFMPNLAAYPKSTTTQSKLYARNTIFGNIYLDSQAYNPVVIKITFNQEADSAYSITL
NYSWGKDYENIPFDSTSFTFSYIAQE

The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ofr:B	186	186	1.0000	1.0000	1.0000	3.38e-136	8ofr:A, 8ofr:C, 8ofr:D, 8ofr:E, 8ofr:F, 8ofr:G, 8ofr:H, 8ofr:I, 8ofr:J, 8ofr:K, 8ofr:L, 8ofr:M, 8ofr:N, 8ofr:O, 8ofr:P, 8ofr:Q, 8ofr:R, 8ofr:S, 8ofr:T, 8ofr:U, 8ofr:V, 8ofr:W, 8ofr:X
2	6stt:A	178	185	0.7473	0.7809	0.7514	2.44e-100	6stt:B
3	8ofv:F	175	186	0.6559	0.6971	0.6559	2.27e-81	8ofv:L
4	4k6u:B	187	184	0.6344	0.6310	0.6413	2.00e-80	4k6t:A, 4k6t:B, 4k6t:C, 4k6t:E, 4k6t:F, 4k6t:G, 4k6u:A, 4k6u:C, 4k6v:A, 4k6v:B, 4k6v:C, 4k6w:A, 4k6w:B, 4k6w:C, 3n0i:A, 3n0i:B, 3qnd:A, 3qnd:B, 3qnd:C, 3qnd:E, 3qnd:F, 3qnd:G, 1uxa:A, 1uxa:B, 1uxa:C, 1uxb:A, 1uxb:B, 1uxb:C, 1uxe:A, 1uxe:B, 2wbw:A, 2wgt:A, 2wgt:B, 2wgt:C, 2wgu:A, 2wgu:B, 2wgu:C, 4xqa:A, 4xqa:B, 4xqa:C, 4xqb:A, 4xqb:B, 4xqb:C
5	6stu:A	204	195	0.5968	0.5441	0.5692	9.20e-73	8ofs:A, 8ofs:B, 8ofs:C
6	6qu6:A	189	188	0.5591	0.5503	0.5532	4.13e-69	6fjo:A, 6qu8:A
7	7op2:A	187	196	0.4892	0.4866	0.4643	3.10e-50	7op2:D, 7op2:G
8	6g47:A	171	184	0.3118	0.3392	0.3152	2.09e-21	6g47:C, 4xl8:A, 4xl8:B, 4xl8:C
9	6dii:H	616	51	0.1075	0.0325	0.3922	2.8	6dii:A, 6dii:B, 6dii:C, 6dii:D, 6dii:E, 6dii:F, 6dii:G, 6dii:I, 6dii:J, 6dii:K, 6dii:L, 8ey1:D, 8ey1:F, 8ey1:H, 8ey1:J, 8ey1:L, 8ey9:B, 8ey9:E, 8ey9:F, 8ey9:G, 8ey9:H, 8ey9:I
10	8sod:A	941	70	0.1075	0.0213	0.2857	3.3	8soe:A
11	8rt6:A	221	52	0.0860	0.0724	0.3077	4.5	7o3j:A, 7o3j:D, 7o3j:G, 7o3j:J, 7o3j:M, 7o3j:P, 7o3j:S, 7o3j:V, 7o3j:Y, 7o3j:b, 7o3j:e, 7o3j:h, 7o3j:k, 7o3j:n, 8rt4:A, 8rt4:D, 8rt4:G, 8rt4:J, 8rt4:M, 8rt4:P, 8rt4:S, 8rt4:V, 8rt4:Y, 8rt4:b, 8rt4:e, 8rt4:h, 8rt4:k, 8rt4:n, 8rt6:D, 8rt6:J, 8rt6:P, 8rt6:S, 8rt6:V, 8rt6:Y, 8rt6:h, 8rt6:k, 8rt6:n, 8rt7:A, 8rt7:D, 8rt7:G, 8rt7:J, 8rt7:M, 8rt7:P, 8rt7:S, 8rt7:V, 8rt7:Y, 8rt7:b, 8rt7:e, 8rt7:h, 8rt7:k, 8rt7:n, 8rt8:A, 8rt8:D, 8rt8:G, 8rt8:J, 8rt8:M, 8rt8:P, 8rt8:S, 8rt8:V, 8rt8:Y, 8rt8:b, 8rt8:e, 8rt8:h, 8rt8:k, 8rt8:n
12	2wbv:B	186	189	0.2097	0.2097	0.2063	4.8	2w9l:C, 2w9l:D, 2w9l:E, 2w9l:F, 2w9l:H, 2w9l:I, 2w9l:L, 2w9l:M, 2w9l:N, 2w9l:Q, 2w9l:R, 2w9l:S, 2wbv:D, 2wbv:A, 2wbv:C, 2wbv:E, 2wbv:F
13	4qiw:B	1069	69	0.1022	0.0178	0.2754	9.8	4qiw:J
14	6kf3:B	1114	69	0.1022	0.0171	0.2754	9.9	9bct:B, 9bcu:B, 6kf4:B, 6kf9:B

[Back]