BioLiP

>protein
KLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAVRRFRGRDAVTNFKSQVDGNDAESAFLDAHSKA
EIVDMLRKHTYADEFEQSR

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7et4:D	104	99	1.0000	0.9519	1.0000	1.24e-71	7et4:A, 7et4:G, 7et4:J
2	5wx9:A	131	59	0.2929	0.2214	0.4915	2.91e-10
3	1gcc:A	63	61	0.2727	0.4286	0.4426	1.49e-09
4	7wq5:A	172	98	0.2828	0.1628	0.2857	2.24e-05	7wq5:B
5	7wq5:A	172	59	0.2929	0.1686	0.4915	3.69e-05	7wq5:B
6	7o9m:d	220	63	0.2020	0.0909	0.3175	1.6	7a5h:d, 7a5j:d, 6i9r:d, 7of0:d, 7of2:d, 7of3:d, 7of4:d, 7of5:d, 7of6:d, 7of7:d, 7og4:d, 7oi6:d, 7oi7:d, 7oi8:d, 7oi9:d, 7oia:d, 7oib:d, 7oid:d, 7oie:d, 5ool:d, 5oom:d, 7pd3:d, 8qu5:d, 6zs9:d, 6zsa:d, 6zsb:d, 6zsc:d, 6zsd:d, 6zse:d, 6zsg:d
7	3n92:A	550	54	0.2121	0.0382	0.3889	2.1	3n98:A
8	4cys:A	534	32	0.1515	0.0281	0.4688	2.4	5aj9:A, 5aj9:B, 4cxk:A, 4cxk:B, 4cxs:A, 4cxs:B, 4cxu:A, 4cxu:B, 4cyr:A, 4cyr:B, 4cys:B, 1hdh:A, 1hdh:B
9	6goc:A	444	45	0.1414	0.0315	0.3111	3.5
10	6ide:B	228	85	0.2222	0.0965	0.2588	3.6	6ide:A, 6kju:A, 6kju:B, 6ugl:B
11	7eoz:A	482	55	0.1616	0.0332	0.2909	4.3	7eoz:B
12	7odr:d	259	49	0.1616	0.0618	0.3265	5.5	8any:d, 7l08:d, 7l20:d, 7o9k:d, 7odt:d, 8oir:Bu, 8oit:Bu, 8pk0:d, 7po4:d, 7qi4:d, 7qi5:d, 7qi6:d, 8qsj:d, 6vlz:d, 6vmi:d, 6zm5:d, 6zm6:d

[Back]