BioLiP

>protein
KKNIIAGASLYLVFYAWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYIEMVLEVLVASVLWGYIWKSRDRKVMSITPREE
LRRHFTHWTWLMMYGIAIYFGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGGASFLYAKTRLPTYQQGLS
LQYLVVVVGPFMILPNVGLNEWGHTFWFMEELFVAPLHYGFVFFGWSALGVLGVINIELGALSKLLKKDLA

The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7s4l:C	231	231	1.0000	1.0000	1.0000	4.84e-171	7s4l:H, 7s4l:I
2	8oyi:C	236	216	0.7273	0.7119	0.7778	6.24e-126	8oyi:G, 8oyi:K, 7s4h:C, 7s4h:G, 7s4h:K, 7s4i:C, 7s4i:G, 7s4i:K, 7s4j:C, 7s4j:G, 7s4j:K, 7s4k:C, 7s4k:G, 7s4k:K, 8sqw:C, 8sqw:G, 8sqw:K, 8sr1:C, 8sr1:G, 8sr1:K, 8sr2:C, 8sr2:G, 8sr2:K, 8sr4:C, 8sr4:G, 8sr4:K, 7t4p:C, 7t4p:G, 7t4p:K
3	1yew:C	188	212	0.6234	0.7660	0.6792	5.99e-101	1yew:G, 1yew:K
4	3rgb:C	213	177	0.5887	0.6385	0.7684	5.87e-100	3rgb:K, 3rgb:G
5	7s4m:K	241	223	0.6190	0.5934	0.6413	6.01e-100	4pi2:C, 4pi2:G, 4pi2:K, 7s4m:G, 7s4m:C
6	4pi0:C	217	223	0.5195	0.5530	0.5381	6.87e-76	4phz:C, 4phz:G, 4phz:K, 4pi0:G, 4pi0:K, 3rfr:C, 3rfr:G, 3rfr:K
7	3chx:C	159	141	0.3810	0.5535	0.6241	1.75e-62	3chx:G, 3chx:K
8	6cxh:C	101	161	0.4372	1.0000	0.6273	3.78e-55
9	7dv6:A	304	57	0.0693	0.0526	0.2807	2.1	5e8y:A, 5e91:A, 5e92:A, 5qin:A
10	2f8n:G	108	43	0.0606	0.1296	0.3256	2.6	1u35:C, 1u35:G
11	3a8i:A	363	88	0.1039	0.0661	0.2727	5.1	3a8i:B, 3a8i:C, 3a8i:D
12	1z3h:A	925	44	0.0649	0.0162	0.3409	6.3
13	6sqg:E	212	50	0.0736	0.0802	0.3400	8.2	6sqg:A, 6sqg:B, 6sqg:C, 6sqg:D

[Back]