KKGVQFDDLLAINSDVMAWLTVKGTHIDYPIVQGENNLEYINKSVEGEYSLSGSVFLDYRNKVTFEDKYSLIYAHHMAGN
VMFGELPNFRKKSFFNKHKEFSIETKTKQKLKINIFACIQTDAFDSLLFNPIDVDISSKNEFLNHIKQKSVQYREILTTN
ESRFVALSTCEDMTTDGRIIVIGQIE
The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3psq:A | 186 | 186 | 1.0000 | 1.0000 | 1.0000 | 5.21e-139 | 3psq:B |
2 | 1qwz:A | 235 | 183 | 0.3333 | 0.2638 | 0.3388 | 1.20e-33 | 4lfd:A, 4lfd:B, 4lfd:C, 4lfd:D, 1qx6:A, 1qxa:A |
3 | 5g0i:A | 722 | 161 | 0.1989 | 0.0512 | 0.2298 | 0.26 | 5g0i:B |
4 | 3tf7:C | 232 | 60 | 0.0806 | 0.0647 | 0.2500 | 0.41 | 3tf7:G |
5 | 8e3s:A | 503 | 32 | 0.0591 | 0.0219 | 0.3438 | 1.6 | 8fzr:A |
6 | 7shl:A | 645 | 49 | 0.0860 | 0.0248 | 0.3265 | 3.0 | |
7 | 5x7g:A | 700 | 98 | 0.1505 | 0.0400 | 0.2857 | 3.6 | 5x7h:A |
8 | 7em5:B | 297 | 76 | 0.1129 | 0.0707 | 0.2763 | 3.8 | 7em6:B |
9 | 1mdc:A | 131 | 48 | 0.0753 | 0.1069 | 0.2917 | 5.0 |