BioLiP

>protein
KIFAVRVTHGQEETTAKLIYSKVRTYNLPIYAILAPSRVKGYIFVEAPNKGVVDEAIRGIRHARGVLPGEVPFKEIEHFL
E

The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8oki:G	81	81	1.0000	1.0000	1.0000	1.32e-54
2	4zn3:A	147	79	0.4444	0.2449	0.4557	2.20e-18
3	8w8e:Z	360	87	0.3704	0.0833	0.3448	1.35e-05	8w8f:Z
4	5oik:Z	488	87	0.3704	0.0615	0.3448	1.36e-05	6gml:Z, 8p4f:Z, 8rbx:Z, 7ycx:j
5	4a8x:A	88	57	0.2222	0.2045	0.3158	0.10
6	5xon:W	329	63	0.2222	0.0547	0.2857	0.29
7	6ir9:W	275	63	0.2222	0.0655	0.2857	0.30	6j4w:W, 6j4x:W, 6j4y:W, 6j4z:W, 6j50:W, 6j51:W, 8jh2:W, 7wbv:W, 7wbw:W, 7wbx:W
8	7xn7:W	533	63	0.2222	0.0338	0.2857	0.37	7xse:W, 7xsx:W, 7xt7:W, 7xtd:W, 7xti:W
9	7nkx:Z	156	66	0.2346	0.1218	0.2879	0.74
10	2exu:A	192	66	0.2346	0.0990	0.2879	0.78
11	1kwg:A	644	49	0.1852	0.0233	0.3061	0.81	1kwk:A
12	3c66:A	529	52	0.1358	0.0208	0.2115	1.0	3c66:B, 1fa0:A, 1fa0:B, 2q66:A
13	3a3w:A	329	16	0.1111	0.0274	0.5625	2.4	3a3x:A, 3a4j:A, 3c86:A, 2d2g:A, 2d2h:A, 2d2j:A, 4np7:A, 3ood:A, 3oqe:A, 2r1k:A, 2r1l:A, 2r1m:A, 2r1n:A, 2r1p:A, 3so7:A, 5vej:A, 5w7h:A, 5w7h:B, 3wml:A
14	1bw9:A	350	47	0.1975	0.0457	0.3404	3.0	1bw9:B, 1bxg:A, 1bxg:B, 1c1d:A, 1c1d:B, 1c1x:A, 1c1x:B
15	2eh1:B	89	34	0.1728	0.1573	0.4118	4.5
16	1kij:A	384	41	0.1481	0.0312	0.2927	4.5	6enh:A, 1kij:B
17	6c8v:A	312	24	0.1358	0.0353	0.4583	6.6
18	7cum:B	675	43	0.1358	0.0163	0.2558	7.0	7c7q:B, 6w2x:B, 6wiv:B
19	6uo8:B	696	43	0.1358	0.0158	0.2558	7.1	7ca3:B, 7eb2:D
20	8ic6:B	855	43	0.2099	0.0199	0.3953	9.8	8ic6:A, 8ic7:B, 8ic7:A

[Back]