KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRV
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1gcc:A | 63 | 63 | 1.0000 | 1.0000 | 1.0000 | 1.61e-41 | |
2 | 5wx9:A | 131 | 58 | 0.6825 | 0.3282 | 0.7414 | 1.11e-26 | |
3 | 7et4:D | 104 | 61 | 0.4286 | 0.2596 | 0.4426 | 9.96e-10 | 7et4:A, 7et4:G, 7et4:J |
4 | 7wq5:A | 172 | 66 | 0.4127 | 0.1512 | 0.3939 | 1.04e-07 | 7wq5:B |
5 | 7wq5:A | 172 | 60 | 0.4127 | 0.1512 | 0.4333 | 0.49 | 7wq5:B |
6 | 1cyg:A | 680 | 32 | 0.1587 | 0.0147 | 0.3125 | 2.0 | |
7 | 7wic:R | 288 | 31 | 0.1746 | 0.0382 | 0.3548 | 3.0 | 7t10:R, 7t11:R, 7wig:R, 7wj5:R, 7xat:A, 7xau:A, 7xav:A, 7xmr:R, 7y24:E, 7y26:E, 7y27:E, 7yac:E, 7yae:E |
8 | 7xn9:A | 476 | 31 | 0.1746 | 0.0231 | 0.3548 | 3.1 | 2b46:X, 1bcx:A, 1bvv:A, 1c5i:A, 8qxy:B, 8qxy:A, 8qy0:B, 8qy0:A, 8qy1:A, 8qy1:B, 8qy2:A, 8qy3:A, 2qz3:A, 2qz3:B, 5tzo:A, 5tzo:B, 5tzo:C, 3vzm:A, 3vzn:A, 3vzn:B, 3vzo:A, 7xna:A |
9 | 3bdn:A | 234 | 30 | 0.1746 | 0.0470 | 0.3667 | 3.2 | 3bdn:B, 2hnf:A, 2ho0:A, 1lli:A, 1lli:B, 1lmb:3, 1lmb:4, 1rio:A, 1rio:B |
10 | 8ity:V | 361 | 21 | 0.1746 | 0.0305 | 0.5238 | 5.0 | 8iue:V, 8iuh:V, 5n9g:A, 5n9g:F, 4roc:A, 4rod:A, 4roe:A |
11 | 8ca1:B | 589 | 32 | 0.2063 | 0.0221 | 0.4062 | 6.1 | 8ca1:A |
12 | 6u83:A | 154 | 22 | 0.1270 | 0.0519 | 0.3636 | 8.1 |