BioLiP

>protein
KHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPL

The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1h88:B	71	68	0.9714	0.9577	1.0000	2.92e-43	2e42:A, 2e42:B, 2e43:A, 2e43:B, 1gtw:A, 1gtw:B, 1gu4:A, 1gu4:B, 1gu5:A, 1gu5:B, 1h88:A, 1h89:A, 1h89:B, 1h8a:A, 1h8a:B, 1hjb:A, 1hjb:B, 1hjb:D, 1hjb:E, 1io4:A, 1io4:B, 8k8d:A, 8k8d:B, 7l4v:A, 7l4v:B, 6mg1:A, 6mg1:B, 6mg2:A, 6mg2:B, 6mg3:A, 6mg3:B, 7upz:A, 7upz:B
2	8k8c:A	60	60	0.6571	0.7667	0.7667	1.24e-27	8k8c:B, 1nwq:A, 1nwq:C
3	8k86:A	63	51	0.2714	0.3016	0.3725	0.19	8k86:B, 8k8a:A, 8k8a:B
4	6sdw:A	177	70	0.2857	0.1130	0.2857	0.55	6htu:A, 6htu:B, 6htu:C, 6sdy:A
5	7qep:S1	209	62	0.2714	0.0909	0.3065	1.5
6	1t2k:D	61	53	0.2571	0.2951	0.3396	1.8
7	6hn5:F	323	22	0.1571	0.0341	0.5000	2.0
8	1ysa:C	57	49	0.2429	0.2982	0.3469	3.1	1dgc:A, 2dgc:A, 1ysa:D
9	7yq5:E	799	22	0.1571	0.0138	0.5000	3.2	7pg0:A, 7pg2:A, 7pg3:A, 7pg4:A, 7sl4:B, 7yq6:E, 7yq6:F
10	2c9l:Y	63	53	0.2429	0.2698	0.3208	3.3	2c9l:Z, 2c9n:Y, 2c9n:Z, 7nx5:A, 7nx5:B, 7nx5:E, 7nx5:F, 5szx:A, 5szx:B
11	8guy:F	835	22	0.1571	0.0132	0.5000	3.5	6ce7:P, 6ce9:M, 6ce9:P, 6ceb:M, 6ceb:P, 8guy:E, 6hn5:E, 5j3h:E, 7kd6:E, 7kd6:K, 7kd6:Q, 7kd6:W, 5kqv:E, 5kqv:F, 7mqo:F, 7mqo:E, 7mqr:E, 7mqr:F, 4oga:E, 7pg0:B, 7pg2:B, 7pg3:B, 7pg4:B, 7qid:C, 7sl3:A, 7sl3:B, 6sof:A, 6sof:C, 7u6e:F, 7u6e:E, 6vep:E, 6vep:K, 6vep:Q, 6vep:W, 6veq:K, 6veq:E, 3w11:E, 3w12:E, 3w13:E, 4xss:E, 4xst:E, 7yq3:F, 7yq3:E, 7yq4:E, 7yq4:F, 7yq5:F
12	4zc0:B	434	43	0.2000	0.0323	0.3256	7.2	3gxv:A
13	4v2i:A	315	34	0.1857	0.0413	0.3824	7.6	4v2i:B

[Back]