BioLiP

>protein
KGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQD
NKADVILKYNADEARSLKAYGELPEHAKI

The query sequence (length=109) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1d7q:A	143	109	1.0000	0.7622	1.0000	1.80e-76	7a09:G, 4kzy:n, 4kzz:n, 8oz0:G, 8p03:j, 8p09:j, 8pj1:q, 8pj2:q, 8pj3:q, 8pj4:q, 8pj5:q, 8pj6:q, 8ppl:Iq, 7qp6:q, 7qp7:q, 7syq:A, 7syr:A, 7sys:A, 7syv:A, 7syw:A, 7syx:A, 7tql:4, 6yal:j, 6yam:j, 6ybw:q, 6zmw:q, 6zp4:G
2	6fyx:i	121	99	0.6239	0.5620	0.6869	2.43e-47	8cah:i, 8cas:A, 6fyy:i, 6gsm:i, 6gsn:i, 3j80:i, 3j81:i, 3jam:i, 3jap:i, 8rw1:i, 8s8d:i, 8s8e:i, 8s8f:i, 8s8g:i, 8s8h:i, 8s8i:i, 8s8j:i, 4uer:0, 6zce:i, 6zu9:A
3	4bts:A0	99	98	0.6147	0.6768	0.6837	7.07e-44	4bts:B0, 4bts:C0, 4bts:D0
4	7ase:w	147	85	0.3578	0.2653	0.4588	4.45e-17
5	5jb3:6	95	86	0.2477	0.2842	0.3140	5.58e-10	5jbh:6, 6sw9:6, 6swc:6, 6swd:6, 7zag:6, 7zah:6, 7zai:6
6	6zxg:j	116	88	0.2294	0.2155	0.2841	1.09e-05	6zxf:j, 6zxh:j
7	6jmv:A	256	23	0.1009	0.0430	0.4783	1.3	8bst:A, 8bst:B, 8bst:C, 8bst:D, 8bsu:A, 8bsu:D, 8bsu:B, 8bsu:C, 8bsu:E, 8bsu:H, 8bsu:F, 8bsu:G, 4e0w:A, 6f28:A, 6f28:B, 6f29:A, 4g8n:A, 4igr:A, 6jmv:B, 4mh5:A, 5nf6:B, 5nf6:A, 4nwc:A, 4nwd:A, 5o4f:B, 5o4f:A, 3s9e:A, 3s9e:B, 3u92:A, 3u92:B, 3u93:A, 3u93:B, 3u94:A, 3u94:B, 3u94:C, 3u94:D
8	7kmq:B	754	35	0.1101	0.0159	0.3429	2.6	7kmq:A
9	3huj:A	275	48	0.1468	0.0582	0.3333	3.0	4en3:C, 3huj:C, 4lhu:A, 4mng:A, 4mng:C, 4mq7:A, 2po6:A, 2po6:E, 3sdx:A, 3sdx:C, 8sgb:A, 8sgm:A, 8sos:A, 8sos:E, 3tzv:C, 3u0p:A, 3u0p:C, 6v7y:A, 6v7z:A, 6v7z:C, 6v80:A, 6v80:F, 3vwj:A, 3vwk:A, 4wo4:A, 4ww2:C, 4wwk:C, 1zt4:A
10	1nui:A	242	66	0.1560	0.0702	0.2576	3.4	1nui:B
11	2a8j:B	313	35	0.1101	0.0383	0.3429	4.3	2a8j:A, 2a8m:A
12	5lth:A	334	32	0.1101	0.0359	0.3750	5.3	5lte:A, 5lti:A
13	6n9x:B	500	66	0.1560	0.0340	0.2576	6.0	1e0j:A, 1e0j:B, 1e0j:C, 1e0j:D, 1e0j:E, 1e0j:F, 6n7i:A, 6n7i:B, 6n7i:C, 6n7i:D, 6n7i:E, 6n7n:A, 6n7n:B, 6n7n:C, 6n7n:D, 6n7n:E, 6n7n:F, 6n7s:A, 6n7s:B, 6n7s:C, 6n7s:D, 6n7s:E, 6n7t:A, 6n7t:B, 6n7t:C, 6n7t:D, 6n7t:E, 6n7t:F, 6n7v:A, 6n7v:B, 6n7v:C, 6n7v:D, 6n7v:E, 6n7v:F, 6n9u:E, 6n9v:A, 6n9v:B, 6n9v:C, 6n9v:D, 6n9v:E, 6n9v:F, 6n9w:A, 6n9w:B, 6n9w:C, 6n9w:D, 6n9w:E, 6n9x:A, 6n9x:C, 6n9x:D, 6n9x:E
14	8fac:A	1377	60	0.1376	0.0109	0.2500	7.1	8e04:A
15	8e05:A	1749	60	0.1376	0.0086	0.2500	7.1	8e05:B, 8e06:A

[Back]