KFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNG
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5xtc:f | 47 | 47 | 1.0000 | 1.0000 | 1.0000 | 1.49e-30 | 5xtd:f, 5xth:f, 5xti:f, 5xti:Bf |
| 2 | 8bso:H | 219 | 24 | 0.1915 | 0.0411 | 0.3750 | 1.1 | 8bjz:H, 8bjz:A, 8bso:C, 6ug9:H, 6ug9:A, 6ug9:J |
| 3 | 3fn0:H | 221 | 24 | 0.1915 | 0.0407 | 0.3750 | 1.5 | |
| 4 | 3bfm:A | 230 | 16 | 0.1702 | 0.0348 | 0.5000 | 2.6 | |
| 5 | 7nfc:A | 3562 | 41 | 0.2340 | 0.0031 | 0.2683 | 3.4 | 8bh3:S, 8bh3:A, 8bhv:A, 8bhv:F, 8bhy:A, 8bhy:S, 8bot:F, 8bot:S, 7nfc:F |
| 6 | 7t0l:G | 218 | 22 | 0.1915 | 0.0413 | 0.4091 | 4.1 | 5eor:H |
| 7 | 3aqz:B | 102 | 31 | 0.2553 | 0.1176 | 0.3871 | 4.2 | 3aqz:A |
| 8 | 8k1l:A | 979 | 25 | 0.2128 | 0.0102 | 0.4000 | 4.7 | |
| 9 | 6ahr:B | 774 | 16 | 0.1489 | 0.0090 | 0.4375 | 5.4 | 6ahu:B |
| 10 | 1dhk:B | 195 | 18 | 0.1489 | 0.0359 | 0.3889 | 5.6 | |
| 11 | 4zke:A | 473 | 37 | 0.2340 | 0.0233 | 0.2973 | 8.5 | 4zkd:A |
| 12 | 8tmy:A | 220 | 21 | 0.1915 | 0.0409 | 0.4286 | 8.6 | 8tmy:C, 8tmy:H |
| 13 | 8p5r:C | 1109 | 21 | 0.1915 | 0.0081 | 0.4286 | 9.7 | 6i2q:A, 6i2r:A, 6i2r:C, 6i2s:A, 8p5r:A, 8p5r:B, 8p5r:D, 8p5r:E, 8p5r:F, 6r2b:A, 6r2b:D, 6r2c:A, 6r2c:B, 6r2c:C, 6r2c:D, 6r2d:A, 6r2d:B, 6r2d:C, 6r2d:D, 2xt6:A, 2xt6:B, 2xta:A, 2xta:B, 2xta:C, 2xta:D, 2y0p:D, 2yic:A, 2yic:B, 2yic:C, 2yic:D, 2yid:A, 2yid:B, 2yid:C, 2yid:D, 3zhq:A, 3zhq:B, 3zhq:C, 3zhq:D, 3zhr:A, 3zhr:B, 3zhr:C, 3zhr:D, 3zhs:A, 3zhs:B, 3zhs:C, 3zhs:D, 3zht:A, 3zht:B, 3zht:C, 3zht:D, 3zhu:A, 3zhu:B, 3zhu:C, 3zhu:D, 3zhv:A, 3zhv:B, 3zhv:C, 3zhv:D |
umich.edu