KFCKCGVRIQTSAYTCSKCRNRSGENNSFFNHKHSDITKSKISEKMKGKKPSNIKKISCDGVIFDCAADAARHFKISSGL
VTYRVKSDKWNWFYIN
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1i3j:A | 96 | 96 | 1.0000 | 1.0000 | 1.0000 | 3.80e-67 | 1t2t:A |
2 | 8bs3:A | 324 | 36 | 0.1146 | 0.0340 | 0.3056 | 4.9 | 8bs9:A, 8bs9:C |
3 | 8je0:A | 378 | 64 | 0.1979 | 0.0503 | 0.2969 | 8.0 | 8je0:B, 8je0:C, 8je0:D |