BioLiP

>protein
KETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEI

The query sequence (length=44) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2q2k:A	45	44	1.0000	0.9778	1.0000	9.32e-27	2q2k:B
2	5ue8:A	847	32	0.2500	0.0130	0.3438	0.19	5ue8:B, 1y8f:A
3	4v4n:AJ	132	37	0.2955	0.0985	0.3514	1.8	4v6u:BJ
4	6skf:BL	140	45	0.3864	0.1214	0.3778	1.9	6skg:BL, 6th6:BL
5	6edk:A	193	23	0.1818	0.0415	0.3478	2.6	6ci4:A, 6ci5:A
6	5van:A	861	40	0.2955	0.0151	0.3250	3.8	6nfj:A, 6nfj:D, 5vaq:A
7	6lvb:A	762	33	0.2955	0.0171	0.3939	4.7	6lvb:C, 6lvb:E, 6lvb:G, 6lvc:A, 6lvc:C, 6lvv:A, 6lvv:C, 6lvv:E, 6lvv:G, 6lvv:I, 6lvv:K, 6lvv:M, 6lvv:O, 7w8j:A, 7w8j:C, 7w8j:E, 7w8j:G
8	6fop:A	717	24	0.2727	0.0167	0.5000	5.8
9	4hnv:B	1033	19	0.2045	0.0087	0.4737	5.9	8gk8:D
10	3bg5:A	1137	19	0.2045	0.0079	0.4737	6.3	3bg5:C, 8gk8:A, 8gk8:B, 3hb9:A, 3hb9:C, 3hbl:A, 3hbl:C, 4hnt:A, 4hnt:C, 4hnu:A, 4hnu:C, 4hnv:A, 4hnv:C
11	3ho8:D	934	19	0.2045	0.0096	0.4737	6.5
12	3bg5:B	1074	19	0.2045	0.0084	0.4737	6.5	3bg5:D, 8gk8:C, 3hb9:B, 3hb9:D, 3hbl:B, 3hbl:D, 4hnt:B, 4hnt:D, 4hnu:B, 4hnu:D, 4hnv:D, 3ho8:A, 3ho8:C, 3ho8:B
13	3esb:A	199	14	0.2045	0.0452	0.6429	6.6	3ef3:A, 3esa:A, 3esa:B, 3esc:A, 3esd:A, 1oxm:A, 1oxm:B, 1xzc:A, 1xzk:A, 1xzk:B, 1xzl:A, 1xzm:A
14	3mb5:A	255	22	0.1818	0.0314	0.3636	7.3	3lga:A, 3lga:B, 3lga:C, 3lga:D, 3lhd:C, 3lhd:A, 3lhd:B, 3lhd:D
15	6nbp:A	246	23	0.2045	0.0366	0.3913	8.3

[Back]