KERERLEEKLEDANERIAELVKLEERQRIARDLEDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEV
RKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEV
VITVSDDGTFKGEENSFHGLLGMRERLEFANGSLHIDTENGTKLTMAIPNN
The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ssj:A | 219 | 214 | 0.9905 | 0.9543 | 0.9766 | 4.28e-150 | 3ehf:A, 3ehf:D, 3ehg:A, 3ehh:A, 3ehh:B, 3ehj:A, 3ehj:B, 3gie:A, 3gie:B, 3gif:A, 3gig:A, 3gig:B, 5iuj:A, 5iuj:B, 5iuj:D, 5iuj:E, 5iuk:A, 5iuk:B, 5iuk:D, 5iuk:E, 5iul:A, 5iul:B, 5iul:D, 5iul:E, 5ium:A, 5ium:B, 7ssi:A, 7ssi:B, 7ssi:D, 7ssi:E, 7ssj:C, 7ssj:D |
2 | 8sbm:B | 126 | 80 | 0.1185 | 0.1984 | 0.3125 | 2.54e-04 | 8sbm:A, 3zxo:A, 3zxo:B |
3 | 4gt8:A | 133 | 104 | 0.1280 | 0.2030 | 0.2596 | 0.12 | |
4 | 6q8n:A | 321 | 82 | 0.1043 | 0.0685 | 0.2683 | 0.69 | 6q8n:B |
5 | 4gwm:A | 561 | 39 | 0.0616 | 0.0232 | 0.3333 | 3.2 | 7aq1:A, 7aq1:B, 7auw:A, 7auw:C, 4gwm:B, 4gwn:A |
6 | 7p63:C | 589 | 107 | 0.1327 | 0.0475 | 0.2617 | 7.4 | 7nyr:D, 7nyu:D, 7nz1:D, 7p64:C, 7p69:C, 7p7c:C, 7p7j:C, 7p7l:C, 7p7m:C, 7z7r:C, 7z7s:C, 7z7t:C, 7z7v:C, 7z80:C, 7z83:C, 7z84:C, 7zc5:C, 7zci:C |
7 | 8fkp:LA | 143 | 83 | 0.0900 | 0.1329 | 0.2289 | 7.9 | 8fkq:LA, 8fkr:LA, 8fks:LA |