KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1npi:A | 61 | 61 | 1.0000 | 1.0000 | 1.0000 | 6.66e-41 | |
2 | 6q2o:E | 572 | 36 | 0.1967 | 0.0210 | 0.3333 | 0.45 | 6q2j:E, 6q2j:F, 6q2o:F, 6q2r:E, 6q2r:F, 6q2r:Y, 6q2r:Z, 6q2s:E, 6q2s:F, 4ux8:A, 4ux8:B |
3 | 6q2n:E | 553 | 35 | 0.2131 | 0.0235 | 0.3714 | 0.81 | 6q2n:F |
4 | 4rul:A | 823 | 26 | 0.1803 | 0.0134 | 0.4231 | 2.5 | 1cy1:A, 1cy2:A, 1cy4:A, 1cy6:A, 1cy7:A, 1cy8:A, 1mw8:X, 3px7:A |
5 | 5oxw:C | 80 | 28 | 0.1639 | 0.1250 | 0.3571 | 4.5 | 5oxw:B, 5oxw:D, 5oxw:A, 5oxx:A |
6 | 6nf6:A | 411 | 23 | 0.1639 | 0.0243 | 0.4348 | 5.1 | 6nf6:B |
7 | 5xd8:B | 367 | 24 | 0.1639 | 0.0272 | 0.4167 | 6.1 | 5xd7:A, 5xd8:A, 5xd9:A |
8 | 4ru4:B | 590 | 37 | 0.1639 | 0.0169 | 0.2703 | 6.8 | 4ru4:A, 4ru4:C, 4ru4:D, 4ru4:E, 4ru4:F |
9 | 5faw:B | 806 | 23 | 0.1475 | 0.0112 | 0.3913 | 8.5 | 5fau:A, 5fau:B, 5fau:C, 5fau:D, 5faw:A, 5fay:A, 5fay:B, 6nd3:A, 6nd3:B, 6nd3:C, 6nd3:D, 6nd3:E, 6nd3:F, 6nd3:G, 6nd3:H, 6vue:A, 6vue:B |
10 | 4r37:A | 255 | 24 | 0.1803 | 0.0431 | 0.4583 | 8.9 |