BioLiP

>protein
KCTKNALAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYCYDPKTQDTFYDVSELQEESPG
KYTANFKKVEKNGNVKVDVTSGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDTNAGDKVKGAVTAASLKF
SDFISTKDNKCEYDNVSLKSLLTK

The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1u17:A	185	184	1.0000	0.9946	1.0000	2.01e-134	1np1:A, 1np1:B, 2np1:A, 2np1:B, 3np1:A, 3np1:B, 4np1:A, 4np1:B, 1u17:B, 1u18:A, 1u18:B
2	2at0:X	184	183	0.8913	0.8913	0.8962	3.59e-118	2at3:X, 2at5:X, 2at6:X, 2at8:X, 3c76:X, 3c77:X, 3c78:X, 1d2u:A, 1d3s:A, 1eqd:A, 1erx:A, 3fll:A, 4gnw:A, 4gnw:B, 4grj:A, 4grj:B, 4hpa:A, 4hpb:A, 4hpc:A, 4hpd:A, 5hwz:A, 1ike:A, 1ikj:A, 1koi:A, 1ml7:A, 3mvf:A, 1np4:A, 2ofr:X, 1sxu:A, 1sxw:A, 1sxx:A, 1sxy:A, 1sy0:A, 1sy1:A, 1sy2:A, 1sy3:A, 3tga:A, 3tgb:A, 3tgc:A, 1u0x:A, 1x8n:A, 1x8o:A, 1x8p:A, 1x8q:A, 1ywa:A, 1ywb:A, 1ywc:A, 1ywd:A
3	2a3f:X	180	175	0.4402	0.4500	0.4629	7.12e-47	2acp:X, 2ah7:X, 2al0:X, 2all:X, 2amm:X, 2asn:X, 1euo:A, 2eu7:X, 2gtf:X, 2hys:A, 1pee:A, 1pm1:X, 1t68:X
4	4xmh:A	185	181	0.3913	0.3892	0.3978	2.01e-36	5m6j:A, 5m6k:A, 4xmc:A, 4xmd:A, 4xme:A, 4xmf:A, 4xmg:A
5	4ge1:A	195	184	0.3370	0.3179	0.3370	3.06e-12	4ge1:B, 4ge1:C, 4ge1:D
6	6n9j:B	356	76	0.1141	0.0590	0.2763	0.28	6n9j:A
7	4v6w:AE	261	90	0.1576	0.1111	0.3222	0.48	6xu6:AE, 6xu7:AE, 6xu8:AE
8	2o2h:A	294	61	0.0924	0.0578	0.2787	0.67	2o2i:A
9	6yxx:BR	196	41	0.0761	0.0714	0.3415	2.4	7aoi:BR, 6hiv:BR, 6hix:BR, 6yxy:BR
10	8fru:k	76	32	0.0652	0.1579	0.3750	3.0	8br8:Ll, 8brm:Ll, 8bsi:Ll, 8bsj:Ll, 8btd:Ll, 8btr:Ll, 7pwg:k, 7pwo:k2
11	5xxb:D	261	78	0.1087	0.0766	0.2564	6.6

[Back]