BioLiP

>protein
KCHRCGSDNVRKMVDSPVGDAWEVYVCEKCCYSWRSTENPVVMEKFKLDDNKIANMGVIPPIPP

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ae4:a	67	64	1.0000	0.9552	1.0000	9.69e-44	7ae4:b, 7ae4:c, 7ae4:d, 7ae4:e, 7ae4:f, 7ae5:b, 7ae5:c, 7ae5:d, 7ae5:e, 7ae5:f, 7ae5:a, 7ae7:a, 7ae7:c, 7ae7:d, 7ae7:e, 7ae7:f
2	8bjd:A	208	25	0.1562	0.0481	0.4000	0.56	8bje:A, 8bk5:A, 2vcd:A
3	6cnb:B	1114	41	0.2500	0.0144	0.3902	0.80	8bws:B, 6cnc:B, 6cnd:B, 6cnf:B, 6eu0:B, 6eu1:B, 6f40:B, 6f41:B, 6f42:B, 6f44:B, 5fj8:B, 5fja:B, 6tut:B, 7z0h:B, 7z1l:B, 7z1m:B, 7z1n:B, 7z1o:B, 7z2z:B, 7z30:B, 7z31:B
4	6vfr:A	428	24	0.1562	0.0234	0.4167	2.1	6vfr:B
5	7xw9:R	288	50	0.2344	0.0521	0.3000	3.0	7wkd:R, 7x1t:A, 7x1u:A
6	4udg:B	321	27	0.1562	0.0312	0.3704	3.5	4udg:A, 4udg:C, 4udg:D, 4udg:E, 4udg:F, 4udi:A, 4udi:B, 4udi:C, 4udi:D, 4udi:E, 4udi:F, 4udj:A, 4udj:B, 4udj:C, 4udj:D, 4udj:E, 4udj:F, 4udk:A, 4udk:B, 4udk:C, 4udk:D, 4udk:E, 4udk:F
7	3sur:A	504	24	0.1406	0.0179	0.3750	3.7	3sus:A, 3sut:A, 3suu:A, 3suv:A, 3suw:A
8	7pt6:9	341	35	0.2031	0.0381	0.3714	4.4	7pt6:I, 7pt7:9
9	8shj:A	334	29	0.1406	0.0269	0.3103	5.4	8shj:B, 8t55:A, 8t55:B
10	2jbs:D	400	34	0.2188	0.0350	0.4118	5.7	2jbs:A, 2jbs:B, 2jbs:C, 2jbt:A, 2jbt:D, 2jbt:B, 2jbt:C
11	8shj:C	306	29	0.1406	0.0294	0.3103	6.5	8t55:C
12	1qyp:A	57	40	0.2188	0.2456	0.3500	8.1
13	6j0x:B	466	31	0.2188	0.0300	0.4516	8.4	6j0w:A, 6j0w:B, 6j0x:A, 6j0x:C, 6j0x:D
14	5j55:A	480	20	0.1406	0.0187	0.4500	9.0	5j53:A, 5j54:A, 7qr6:A, 7qr6:B, 7qr6:C
15	5oh7:C	82	46	0.1406	0.1098	0.1957	9.5

[Back]