KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLGLPLVGRVAAGE
IEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQGNKVELLPENSE
FKPIVVDLRQQSFTIEGLAVGVIRNGDWL
The query sequence (length=189) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3jsp:A | 194 | 194 | 0.9841 | 0.9588 | 0.9588 | 2.57e-129 | 3jso:A, 3jso:B, 3jsp:B |
2 | 8b0v:A | 124 | 123 | 0.4074 | 0.6210 | 0.6260 | 1.09e-47 | 8b0v:B |
3 | 8uo4:A | 292 | 55 | 0.0899 | 0.0582 | 0.3091 | 1.9 | 8uo2:A |
4 | 4z7u:B | 169 | 54 | 0.0847 | 0.0947 | 0.2963 | 1.9 | 4gg6:B |
5 | 2i02:A | 140 | 104 | 0.1534 | 0.2071 | 0.2788 | 2.2 | 2i02:B |
6 | 3lba:A | 260 | 32 | 0.0635 | 0.0462 | 0.3750 | 2.3 | |
7 | 8e6n:A | 398 | 45 | 0.0847 | 0.0402 | 0.3556 | 2.4 | 8e60:A, 8e6h:A, 8e6i:A, 8e6l:A |
8 | 6or5:A | 2058 | 40 | 0.0741 | 0.0068 | 0.3500 | 2.9 | |
9 | 6o9a:A | 271 | 68 | 0.1111 | 0.0775 | 0.3088 | 3.1 | 6o9a:B |
10 | 1yf3:A | 259 | 29 | 0.0635 | 0.0463 | 0.4138 | 4.7 | 1q0s:A, 1q0t:A, 1q0t:B, 1yf3:B, 1yfj:A, 1yfj:B, 1yfj:C, 1yfj:D, 1yfj:E, 1yfj:F, 1yfl:A, 1yfl:B, 1yfl:D, 1yfl:E |
11 | 4ft6:A | 387 | 42 | 0.0688 | 0.0336 | 0.3095 | 4.9 | |
12 | 8ome:A | 298 | 41 | 0.0741 | 0.0470 | 0.3415 | 5.0 | 2hw1:A, 8ome:D, 8ome:B, 8ome:C |
13 | 8ug1:B | 305 | 41 | 0.0741 | 0.0459 | 0.3415 | 5.3 | 9fhd:A, 9fhd:B, 9fhe:A, 9fhe:B, 3nbv:A, 3nbv:B, 3nbw:A, 3nbw:B, 3nc2:A, 3nc2:B, 3nc9:A, 3nc9:B, 3nca:A, 8omf:A, 8omf:B, 8omj:A, 8omj:B, 8omk:A, 8omk:B, 3q92:A, 3q92:B, 3qa2:A, 3qa2:B, 3qai:A, 3qai:B, 3ro4:A, 8ug1:A, 8ug3:A, 8ug3:B, 6ul7:A, 6w0n:A, 6w0n:B, 6w0w:A, 6w0w:B, 6w0x:A, 6w0x:B, 6w0y:A, 6w0y:B, 6w0z:A, 6w0z:B, 5wbm:A, 5wbm:B, 5wbo:A, 5wbo:B, 5wbp:A, 5wbq:A, 5wbq:B, 5wbr:A, 5wbr:B, 5wbz:A, 5wbz:B |
14 | 5t0h:V | 480 | 83 | 0.1376 | 0.0542 | 0.3133 | 6.6 | 6epe:S, 6epf:S, 5vft:V |
15 | 4v8p:BS | 126 | 38 | 0.0794 | 0.1190 | 0.3947 | 7.7 | 4v8p:CS, 4v8p:ES, 4v8p:GS |
16 | 4wei:A | 259 | 72 | 0.0952 | 0.0695 | 0.2500 | 8.0 |