KAERAISLLEKDNKGNYLLTTSQIRKLLSLCSSLYDRSKERKFDELINDVSYLRVQFVYQAGREIAVKDLIEKAQILEAL
KEIKDRETLQRFCRYMEALVAYFKFYGG
The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6nud:A | 108 | 108 | 1.0000 | 1.0000 | 1.0000 | 2.77e-74 | 6nud:B |
2 | 6ifk:D | 121 | 111 | 0.7315 | 0.6529 | 0.7117 | 2.17e-50 | 6ifk:C, 6ifl:B, 6ifl:C, 6ifr:D, 6ifr:C, 6ifu:B, 6ifu:C, 6ify:D, 6ify:C, 6ifz:D, 6ifz:C, 6ig0:D, 6ig0:C |
3 | 6xn3:C | 139 | 101 | 0.3519 | 0.2734 | 0.3762 | 1.55e-19 | 9ash:D, 9asi:D, 9asi:E, 9asi:C, 6xn3:D, 6xn3:E, 6xn4:C, 6xn4:D, 6xn7:C, 6xn7:D, 6xn7:E |
4 | 7v01:I | 117 | 95 | 0.2963 | 0.2735 | 0.3368 | 6.47e-13 | 8do6:C, 8do6:D, 7uzy:I, 7v01:K |
5 | 7uzy:K | 59 | 65 | 0.1852 | 0.3390 | 0.3077 | 3.71e-06 | |
6 | 6mur:B | 162 | 96 | 0.2407 | 0.1605 | 0.2708 | 8.88e-05 | 6mus:B, 6o7e:B, 6o7h:B, 6o7i:B |
7 | 6mus:J | 121 | 93 | 0.2315 | 0.2066 | 0.2688 | 0.004 | |
8 | 8xmn:A | 1277 | 65 | 0.1759 | 0.0149 | 0.2923 | 1.1 | 8i5b:A, 8i5g:A, 8i5x:A, 8i5y:A, 8j4f:A, 8s9b:A, 8s9c:A, 8thg:A, 8thh:A, 7xve:A, 7xvf:A |
9 | 8x6f:D | 1176 | 47 | 0.1667 | 0.0153 | 0.3830 | 3.0 | 8x6g:D |
10 | 4i9b:A | 496 | 46 | 0.1296 | 0.0282 | 0.3043 | 6.1 | 4i8q:A, 4i9b:B |
11 | 1a3w:A | 492 | 49 | 0.1481 | 0.0325 | 0.3265 | 7.0 | 1a3w:B, 1a3x:A, 1a3x:B |
12 | 7ar9:n | 120 | 30 | 0.1019 | 0.0917 | 0.3667 | 9.6 | 7ard:n |